Drosophila melanogaster angiotensin converting enzyme homologue, AnCE in complex with RW dipeptide. Determined by X-ray diffraction at 1.9 Å resolution. Released 14 May 2025.
Explore 9QA2 in 3D Show helices and sheets RCSB PDB PDBe
9QA2 contains 38 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 18-51 | 34 | |
| α-helix | 56-80 | 25 | |
| α-helix | 85-87 | 3 | |
| α-helix | 91-101 | 11 | |
| α-helix | 104-107 | 4 | |
| α-helix | 110-129 | 20 | |
| β-strand | 131-132 | 2 | 1 |
| β-strand | 134 | 1 | 2 |
| β-strand | 137 | 1 | 2 |
| β-strand | 143-144 | 2 | 1 |
| α-helix | 145-149 | 5 | |
| α-helix | 150-155 | 6 | |
| α-helix | 159-173 | 15 | |
| α-helix | 175-177 | 3 | |
| α-helix | 178-194 | 17 | |
| α-helix | 200-205 | 6 | |
| α-helix | 206-208 | 3 | |
| α-helix | 213-243 | 31 | |
| α-helix | 253 | 1 | |
| β-strand | 254-255 | 2 | 3 |
| α-helix | 256-258 | 3 | |
| α-helix | 268-270 | 3 | |
| α-helix | 271-274 | 4 | |
| α-helix | 286-291 | 6 | |
| α-helix | 296-309 | 14 | |
| α-helix | 313-316 | 4 | |
| α-helix | 317-322 | 6 | |
| β-strand | 324 | 1 | 4 |
| β-strand | 339-342 | 4 | 4 |
| β-strand | 349-352 | 4 | 4 |
| α-helix | 359-377 | 19 | |
| α-helix | 383-385 | 3 | |
| α-helix | 391-405 | 15 | |
| α-helix | 408-413 | 6 | |
| α-helix | 424-438 | 15 | |
| α-helix | 441-456 | 16 | |
| α-helix | 462-464 | 3 | |
| α-helix | 465-477 | 13 | |
| β-strand | 479-480 | 2 | 3 |
| β-strand | 485-486 | 2 | 5 |
| α-helix | 492-494 | 3 | |
| α-helix | 496-499 | 4 | |
| α-helix | 505-524 | 20 | |
| α-helix | 537-539 | 3 | |
| α-helix | 546-556 | 11 | |
| α-helix | 564-572 | 9 | |
| α-helix | 580-599 | 20 | |
| α-helix | 607-609 | 3 | |
| β-strand | 612-613 | 2 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Arg-trp | B, C | protein | 2 | Bos taurus | |
| Angiotensin-converting enzyme | A | protein | 598 | Drosophila melanogaster | Q10714 (AlphaFold model) |
>9QA2_1 ARG-TRP (chains B, C) RW
>9QA2_2 Angiotensin-converting enzyme (chains A) ALVKEEIQAKEYLENLNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEV ASDTTKFQWRSYQSEDLKRQFKALTKLGYAALPEDDYAELLDTLSAMESNFAKVKVCDYK DSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAGTAVRSQFERYVELNTKAAKLNN FTSGAEAWLDEYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPM HLLGNMWAQQWSEIADIVSPFPEKPLVDVSAEMEKQGYTPLKMFQMGDDFFTSMNLTKLP QDFWDKSIIEKPTDGRDLVCHASAWDFYLIDDVRIKQCTRVTQDQLFTVHHELGHIQYFL QYQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGLLKDYVRDDEARINQLFLTAL DKIVFLPFAFTMDKYRWSLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAKY HISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPLDNCDIYGSAAAGAAFHNML SMGASKPWPDALEAFNGERIMSGKAIAEYFEPLRVWLEAENIKNNVHIGWTTSNKCVS
Molecular Basis of Dipeptide Recognition in Drosophila melanogaster Angiotensin I-Converting Enzyme Homologue, AnCE. Zukowska, J., Gregory, K.S., Robinson, A. et al. Biomolecules (2025) 15. DOI 10.3390/biom15040591 · PubMed
Other PDB entries of the same protein (UniProt Q10714 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9QA2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.