9QFW: Actin, cytoplasmic 1, N-terminally processed

Cryo-EM structure of the cofilactin barbed end bound by two AIP1 molecules. Determined by electron microscopy at 3.16 Å resolution. Released 8 Oct 2025.

Method: Electron microscopy
Resolution: 3.16 Å
Organism: Homo sapiens
Chains: 12
Atoms: 29,759
Mol. weight: 476.6 kDa
Ligands: ADP, MG
Released: 8 Oct 2025

Explore 9QFW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9QFW contains 155 α-helices and 265 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
β-strand	16-21	6	1
β-strand	29-32	4	1
β-strand	35-36	2	2
β-strand	38	1	3
β-strand	53-54	2	2
α-helix	56-60	5
α-helix	62-64	3
β-strand	65	1	3
β-strand	68	1	2
β-strand	71	1	4
β-strand	76	1	4
α-helix	79-87	9
α-helix	88-93	6
α-helix	98-100	3
β-strand	103-107	5	1
α-helix	113-121	9
α-helix	122-126	5
β-strand	131-136	6	1
α-helix	137-144	8
β-strand	150-155	6	5
β-strand	160-166	7	5
β-strand	169-170	2	5
α-helix	172-174	3
β-strand	176-178	3	5
α-helix	182-196	15
α-helix	203-216	14
α-helix	223-231	9
β-strand	238-241	4	6
β-strand	247-250	4	6
α-helix	253-259	7
α-helix	264-267	4
α-helix	274-283	10
α-helix	290-294	5
β-strand	297-300	4	5
α-helix	303-305	3
α-helix	309-320	12
β-strand	329-330	2	5
α-helix	338-347	10
α-helix	350-354	5
β-strand	357-358	2	1
α-helix	359-365	7
α-helix	369-373	5

Chain B: 23 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	7
β-strand	16-21	6	7
β-strand	29-32	4	7
β-strand	35-38	4	8
β-strand	53-54	2	8
α-helix	56-60	5
α-helix	62-64	3
β-strand	65-68	4	8
β-strand	71	1	9
β-strand	76	1	9
α-helix	79-87	9
α-helix	88-93	6
α-helix	98-100	3
β-strand	103-107	5	7
α-helix	113-125	13
β-strand	131-136	6	7
α-helix	137-144	8
β-strand	150-155	6	10
β-strand	160-166	7	10
β-strand	169-170	2	10
α-helix	172-174	3
β-strand	176-178	3	10
α-helix	182-193	12
α-helix	194-196	3
α-helix	203-216	14
α-helix	223-231	9
β-strand	238-241	4	11
β-strand	247-250	4	11
α-helix	253-259	7
α-helix	264-267	4
α-helix	274-283	10
α-helix	287-289	3
α-helix	290-295	6
β-strand	297-300	4	10
α-helix	303-305	3
α-helix	309-320	12
β-strand	329-330	2	10
α-helix	338-348	11
α-helix	350-354	5
β-strand	357-358	2	7
α-helix	359-365	7
α-helix	369-373	5

Chain C: 23 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	12
β-strand	16-21	6	12
β-strand	29-32	4	12
β-strand	35-38	4	13
β-strand	53-54	2	13
α-helix	56-59	4
α-helix	62-64	3
β-strand	65-68	4	13
β-strand	71	1	14
β-strand	76	1	14
α-helix	79-87	9
α-helix	88-93	6
α-helix	98-100	3
β-strand	103-107	5	12
α-helix	113-125	13
β-strand	131-136	6	12
α-helix	137-144	8
β-strand	150-155	6	15
β-strand	160-166	7	15
β-strand	169-170	2	15
α-helix	172-174	3
β-strand	176-178	3	15
α-helix	182-193	12
α-helix	194-196	3
α-helix	203-216	14
α-helix	223-232	10
β-strand	238-241	4	16
β-strand	247-250	4	16
α-helix	253-259	7
α-helix	264-267	4
α-helix	274-283	10
α-helix	287-294	8
β-strand	297-300	4	15
α-helix	303-305	3
α-helix	309-320	12
β-strand	329-330	2	15
α-helix	338-348	11
α-helix	353-355	3
β-strand	357-358	2	12
α-helix	359-365	7
α-helix	367-369	3
α-helix	370-373	4

Chain D: 19 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	17
β-strand	16-21	6	17
β-strand	29-32	4	17
β-strand	35-38	4	18
β-strand	53-54	2	18
α-helix	56-59	4
β-strand	65-68	4	18
β-strand	71	1	19
β-strand	76	1	19
α-helix	79-87	9
α-helix	88-93	6
β-strand	103-107	5	17
α-helix	113-125	13
β-strand	131-136	6	17
α-helix	137-144	8
β-strand	150-155	6	20
β-strand	160-166	7	20
β-strand	169-170	2	20
β-strand	176-178	3	20
α-helix	182-193	12
α-helix	203-216	14
α-helix	223-232	10
β-strand	238-241	4	21
β-strand	247-250	4	21
α-helix	253-259	7
α-helix	264-267	4
α-helix	274-283	10
α-helix	287-294	8
β-strand	297-300	4	20
α-helix	303-305	3
α-helix	309-320	12
β-strand	329-330	2	20
α-helix	338-346	9
α-helix	350-355	6
β-strand	357-358	2	17
α-helix	359-365	7
α-helix	366-368	3
α-helix	369-373	5

Chain E: 23 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	22
β-strand	16-21	6	22
β-strand	29-32	4	22
β-strand	35-38	4	23
β-strand	53-54	2	23
α-helix	56-59	4
α-helix	62-64	3
β-strand	65-68	4	23
β-strand	71	1	24
β-strand	76	1	24
α-helix	79-87	9
α-helix	88-93	6
β-strand	96	1	25
α-helix	98-100	3
β-strand	103-107	5	22
α-helix	113-121	9
α-helix	122-126	5
β-strand	131-136	6	22
α-helix	137-144	8
β-strand	150-155	6	26
β-strand	160-166	7	26
β-strand	169-170	2	26
β-strand	176-178	3	26
α-helix	182-193	12
α-helix	194-196	3
α-helix	203-216	14
α-helix	223-230	8
β-strand	238-241	4	27
β-strand	247-250	4	27
α-helix	253-259	7
α-helix	264-267	4
α-helix	274-283	10
α-helix	290-295	6
β-strand	297-300	4	26
α-helix	303-305	3
α-helix	309-320	12
β-strand	329-330	2	26
α-helix	338-348	11
α-helix	350-355	6
β-strand	357-358	2	22
α-helix	359-365	7
α-helix	366-369	4
α-helix	370-373	4

Chain F: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	28
α-helix	9-19	11
α-helix	26-29	4
β-strand	33-40	8	28
β-strand	46-56	11	28
β-strand	60	1	29
β-strand	64	1	29
α-helix	67-74	8
β-strand	81-91	11	28
β-strand	95-104	10	28
α-helix	111-127	17
β-strand	133-137	5	28
α-helix	140-144	5
α-helix	146-153	8
β-strand	158-161	4	28
β-strand	164-165	2	28

Chain G: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	5	1
β-strand	6-7	2	30
α-helix	8	1
α-helix	9-19	11
α-helix	26-29	4
β-strand	33-40	8	30
β-strand	46-56	11	30
β-strand	60	1	31
β-strand	64	1	31
α-helix	67-74	8
β-strand	81-91	11	30
β-strand	95-104	10	30
α-helix	111-127	17
β-strand	133-137	5	30
α-helix	141-144	4
α-helix	146-153	8
β-strand	158-161	4	30
β-strand	164-165	2	30

Chain H: 9 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	5	1
β-strand	6-7	2	32
α-helix	8	1
α-helix	9-19	11
β-strand	21	1	25
α-helix	26-29	4
β-strand	33-40	8	32
β-strand	46-56	11	32
β-strand	60	1	33
β-strand	64	1	33
α-helix	67-74	8
β-strand	81-91	11	32
β-strand	95-104	10	32
α-helix	111-119	9
α-helix	121-127	7
β-strand	133-137	5	32
α-helix	140-144	5
α-helix	147-153	7
β-strand	158-161	4	32
β-strand	164-165	2	32

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin, cytoplasmic 1, N-terminally processed	A, B, C, D, E	protein	374	Homo sapiens	P60709 (AlphaFold model)
Cofilin-1	F, G, H, I, J	protein	166	Homo sapiens	P23528 (AlphaFold model)
WD repeat-containing protein 1,Methylated-DNA--protein-cysteine methyltransferase	P, Q	protein	805	Homo sapiens	O75083 (AlphaFold model), P16455 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>9QFW_1 Actin, cytoplasmic 1, N-terminally processed (chains A, B, C, D, E)
DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ
IMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLA
GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYE
LPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSG
GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE
YDESGPSIVHRKCF

Sequence of entity 2 (F, G, H, I, J), FASTA

>9QFW_2 Cofilin-1 (chains F, G, H, I, J)
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV
GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Sequence of entity 3 (P, Q), FASTA

>9QFW_3 WD repeat-containing protein 1,Methylated-DNA--protein-cysteine methyltransferase (chains P, Q)
GAMGSMPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDNPALADIYT
EHAHQVVVAKYAPSGFYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSK
RIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFE
GPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDG
GIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSV
SLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGE
NDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAV
GPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSIL
GTTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKI
VCLAWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSH
DASVKEWTITYGTGGGGSGGGGSMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKG
TSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQ
VLWKLLKVVKFGEVISYQQLAALAGNPAATAAVKTALSGNPVPILIPCHRVVSSSGAVGG
YEGGLAVKEWLLAHEGHRLGKPGLG

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	5
MG	Magnesium ion	Mg	5

Primary citation

Choreography of rapid actin filament disassembly by coronin, cofilin, and AIP1. Oosterheert, W., Boiero Sanders, M., Hofnagel, O. et al. Cell (2025) 188:6845. DOI 10.1016/j.cell.2025.09.016 · PubMed

Other PDB entries of the same protein (UniProt P60709 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MBK 1.69 Å, SETD3, a Histidine Methyltransferase, in Complex with an Actin Peptide and SAH, First…
6OX0 1.75 Å, SETD3 in Complex with an Actin Peptide with Sinefungin Replacing SAH as Cofactor
6MBJ 1.78 Å, SETD3, a Histidine Methyltransferase, in Complex with an Actin Peptide and SAH, P21…
6OX3 1.78 Å, SETD3 in Complex with an Actin Peptide with His73 Replaced with Lysine
7W28 1.79 Å, Crystal Structure of SETD3-SAH in complex with betaA-4PyrAla73 peptide
6OX1 1.95 Å, SETD3 in Complex with an Actin Peptide with Target Histidine Partially Methylated
6ICT 1.95 Å, Structure of SETD3 bound to SAH and methylated actin
6OX2 2.09 Å, SETD3in Complex with an Actin Peptide with the Target Histidine Fully Methylated
6OX5 2.1 Å, A SETD3 Mutant (N255A) in Complex with an Actin Peptide with His73 Replaced with Lysine
6ICV 2.15 Å, Structure of SETD3 bound to SAH and unmodified actin
9QEW 2.18 Å, Cryo-EM structure of the undecorated actin filament in the ADP-Pi state.
6MBL 2.2 Å, SETD3, a Histidine Methyltransferase, in Complex with an Actin Peptide and SAH, Second…

Browse structure collections

About this viewer

MolViewer shows 9QFW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.