9QVD: TolQRA in nanodiscs

cryo-EM structure of TolQRA in nanodiscs. Determined by electron microscopy at 3.52 Å resolution. Released 17 Dec 2025.

Method: Electron microscopy
Resolution: 3.52 Å
Organism: Escherichia coli str. K-12 substr. MG1655
Chains: 10
Atoms: 9,570
Mol. weight: 288.61 kDa
Released: 17 Dec 2025

Explore 9QVD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9QVD contains 48 α-helices and 0 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	6-12	7
α-helix	18-56	39
α-helix	62-72	11
α-helix	79-96	18
α-helix	101-123	23
α-helix	127-158	32
α-helix	168-174	7
α-helix	176-219	44

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	6-11	6
α-helix	15-56	42
α-helix	62-72	11
α-helix	79-95	17
α-helix	101-123	23
α-helix	128-156	29
α-helix	164-218	55

Chain C: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	6-12	7
α-helix	15-56	42
α-helix	62-69	8
α-helix	73-75	3
α-helix	79-96	18
α-helix	101-123	23
α-helix	128-158	31
α-helix	168-219	52

Chain D: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	6-12	7
α-helix	15-56	42
α-helix	62-72	11
α-helix	73-75	3
α-helix	79-95	17
α-helix	101-123	23
α-helix	128-156	29
α-helix	164-174	11
α-helix	176-219	44

Chain E: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	6-12	7
α-helix	15-56	42
α-helix	62-71	10
α-helix	73-75	3
α-helix	79-95	17
α-helix	101-123	23
α-helix	127-156	30
α-helix	161-162	2
α-helix	164-183	20
α-helix	186-219	34

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	21-34	14

Chain G: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	15-17	3
α-helix	19-34	16

Chains H, I and J: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-33	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tol-Pal system protein TolQ	A, B, C, D, E	protein	230	Escherichia coli str. K-12 substr. MG1655	P0ABU9 (AlphaFold model)
Tol-Pal system protein TolR	F, G	protein	142	Escherichia coli str. K-12 substr. MG1655	P0ABV6 (AlphaFold model)
Tol-Pal system protein TolA	H, I, J	protein	421	Escherichia coli str. K-12 substr. MG1655	P19934 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>9QVD_1 Tol-Pal system protein TolQ (chains A, B, C, D, E)
MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGI
ELSRLYQESQGKRDNLTGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNREL
ENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI
GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQAFTVSESNKG

Sequence of entity 2 (F, G), FASTA

>9QVD_2 Tol-Pal system protein TolR (chains F, G)
MARARGRGRRDLKSEINIVPLLDVLLVLLLIFMATAPIITQSVEVDLPDATESQAVSSND
NPPVIVEVSGIGQYTVVVEKDRLERLPPEQVVAEVSSRFKANPKTVFLIGGAKDVPYDEI
IKALNLLHSAGVKSVGLMTQPI

Sequence of entity 3 (H, I, J), FASTA

>9QVD_3 Tol-Pal system protein TolA (chains H, I, J)
MSKATEQNDKLKRAIIISAVLHVILFAALIWSSFDENIEASAGGGGGSSIDAVMVDSGAV
VEQYKRMQSQESSAKRSDEQRKMKEQQAAEELREKQAAEQERLKQLEKERLAAQEQKKQA
EEAAKQAELKQKQAEEAAAKAAADAKAKAEADAKAAEEAAKKAAADAKKKAEAEAAKAAA
EAQKKAEAAAAALKKKAEAAEAAAAEARKKAATEAAEKAKAEAEKKAAAEKAAADKKAAA
EKAAADKKAAEKAAAEKAAADKKAAAEKAAADKKAAAAKAAAEKAAAAKAAAEADDIFGE
LSSGKNAPKTGGGAKGNNASPAGSGNTKNNGASGADINNYAGQIKSAIESKFYDASSYAG
KTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAKIPKPPSQAVYEVFKNAPLDFK
P

Primary citation

Deciphering the molecular mechanism of the bacterial division motor TolQRA. Shen, C., Xie, T., Luo, Y. et al. Cell Discov (2025) 11:87-87. DOI 10.1038/s41421-025-00841-w · PubMed

Other PDB entries of the same protein (UniProt P0ABU9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9O40 2.92 Å, cryo-EM structure of TolQR conformation1 in SMA nanodiscs
9DDM 2.94 Å, E. coli TolAQR conformation I
9DDN 3.18 Å, E. coli TolAQR conformation II
9KPZ 3.18 Å, Structure of TolQRA complex at pH 5.4 from E.coli
9QUQ 3.28 Å, cryo-EM structure of TolQR conformation2 in SMA nanodiscs
9K49 3.6 Å, Cryo-EM structure of inner membrane TolQRA complex in CYMAL-6-Neopentyl Glycol detergent…
9KQ0 3.6 Å, Structure of TolQRA complex at pH 8.0 from E.coli
9KCH 4.19 Å, Cryo-EM structure of inner membrane TolQRA complex in CYMAL-6-Neopentyl Glycol detergent…
8ODT 4.2 Å, Structure of TolQR complex from E.coli

Browse structure collections

About this viewer

MolViewer shows 9QVD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.