9R5Y: C-terminal domain of human TNC

Crystal structure of the C-terminal domain of human TNC in complex with Adhiron 52. Determined by X-ray diffraction at 1.4 Å resolution. Released 18 Jun 2025.

Method: X-ray diffraction
Resolution: 1.4 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 4,968
Mol. weight: 71.12 kDa
Released: 18 Jun 2025

Explore 9R5Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9R5Y contains 23 α-helices and 38 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	1984-1989	6
β-strand	1996-2001	6	1
α-helix	2002-2004	3
β-strand	2009-2015	7	1
α-helix	2018-2020	3
β-strand	2023-2029	7	1
α-helix	2040-2045	6
β-strand	2047-2048	2	1
β-strand	2054-2055	2	1
α-helix	2058-2065	8
β-strand	2070-2078	9	1
β-strand	2081-2092	12	1
α-helix	2095-2097	3
β-strand	2101-2108	8	1
α-helix	2115-2117	3
α-helix	2120-2122	3
β-strand	2123	1	2
β-strand	2124	1	3
β-strand	2127	1	3
α-helix	2136-2139	4
β-strand	2144	1	2
β-strand	2152-2153	2	4
β-strand	2168-2169	2	4
α-helix	2170-2173	4
β-strand	2181-2188	8	1
α-helix	2189-2192	4

Chain B: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	34-38	5	5
β-strand	48-53	6	5
β-strand	66-76	11	5
β-strand	79-86	8	5

Chain C: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
α-helix	6-20	15
β-strand	34-38	5	6
β-strand	48-53	6	6
β-strand	66-76	11	6
β-strand	79-90	12	6

Chain D: 10 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	1984-1989	6
β-strand	1996-2001	6	7
α-helix	2002-2004	3
β-strand	2009-2015	7	7
α-helix	2018-2020	3
β-strand	2023-2029	7	7
α-helix	2040-2045	6
β-strand	2047-2048	2	7
β-strand	2054-2055	2	7
α-helix	2058-2065	8
β-strand	2070-2078	9	7
β-strand	2081-2092	12	7
α-helix	2095-2097	3
β-strand	2101-2108	8	7
α-helix	2115-2117	3
α-helix	2120-2122	3
β-strand	2123	1	8
β-strand	2124	1	9
β-strand	2127	1	9
α-helix	2136-2139	4
β-strand	2144	1	8
β-strand	2152-2153	2	10
β-strand	2168-2169	2	10
α-helix	2170-2173	4
β-strand	2181-2188	8	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tenascin	A, D	protein	219	Homo sapiens	P24821 (AlphaFold model)
Adhiron	B, C	protein	88	synthetic construct

Sequence of entity 1 (A, D), FASTA

>9R5Y_1 Tenascin (chains A, D)
LLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAQALEVFCDMTSDGGGWIVFLRRKNGREN
FYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDA
KTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLM
GRYGDNNHSEGVNWFHWKGHEHSIQFAEMKLRPSNFRNA

Sequence of entity 2 (B, C), FASTA

>9R5Y_2 Adhiron (chains B, C)
SLEIEELARFAVDEHNKKENALLEFVRVVKAKEQGANMHAYADTMYYLTLEAKDGGKKKL
YEAKVWVKWEMSRRLMTNFKELQEFKPV

Primary citation

Targeting Tenascin-C-Toll-like Receptor 4 signalling with Adhiron-derived small molecules - a viable strategy for reducing fibrosis in systemic sclerosis. Gaule, T., Simmons, K.J., Walker, K. et al. Bioorg Chem (2025) 167:109251-109251. DOI 10.1016/j.bioorg.2025.109251 · PubMed

Other PDB entries of the same protein (UniProt P24821 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5R61 1.38 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
5R62 1.4 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
6QNV 1.4 Å, Fibrinogen-like globe domain of Human Tenascin-C
2RB8 1.45 Å, High resolution design of a protein loop
5R5U 1.52 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
5R5T 1.55 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
5R5X 1.56 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
5R5Y 1.57 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
5R63 1.59 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
5R5W 1.6 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
5R5Z 1.67 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…
5R5V 1.7 Å, PanDDA analysis group deposition -- Crystal Structure of FIBRINOGEN-LIKE GLOBE DOMAIN OF…

Browse structure collections

About this viewer

MolViewer shows 9R5Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.