9RGE: Human alpha1beta3gamma2 GABA(A)R

CryoEM structure of human alpha1beta3gamma2 GABA(A)R in complex with GARLH4 and the Neuroligin2 transmembrane helix, in CL47a. Determined by electron microscopy at 3.1 Å resolution. Released 17 Jun 2026.

Method: Electron microscopy
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 7
Atoms: 16,281
Mol. weight: 275.6 kDa
Ligands: PIO, PLM, HEX, PGW
Released: 17 Jun 2026

Explore 9RGE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9RGE contains 74 α-helices and 73 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	13-21	9
β-strand	39-54	16	1
β-strand	59-71	13	1
α-helix	73-75	3
β-strand	83-86	4	1
α-helix	88-91	4
β-strand	99-101	3	2
β-strand	104	1	1
β-strand	108-109	2	1
β-strand	117-122	6	1
β-strand	126-138	13	1
β-strand	150-159	10	2
β-strand	167-171	5	1
α-helix	175-178	4
β-strand	179-181	3	1
β-strand	186	1	1
β-strand	191-204	14	2
β-strand	209-221	13	2
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-243	12
α-helix	244-246	3
α-helix	252-275	24
α-helix	285-310	26
α-helix	387-390	4
α-helix	391-415	25

Chain B: 15 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	10-20	11
α-helix	28	1
α-helix	35	1
β-strand	36-51	16	3
β-strand	56-68	13	3
α-helix	70-72	3
β-strand	81-83	3	3
α-helix	85-88	4
β-strand	96-98	3	4
β-strand	103-106	4	3
β-strand	110	1	5
β-strand	114-118	5	3
β-strand	123-135	13	3
β-strand	147-156	10	4
β-strand	164-168	5	3
α-helix	171-173	3
β-strand	175-176	2	3
β-strand	186-199	14	4
β-strand	204-216	13	4
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-236	10
α-helix	237-241	5
α-helix	247-271	25
α-helix	280-303	24
α-helix	304-308	5
α-helix	310-313	4
α-helix	420-446	27

Chain C: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	28-35	8
α-helix	50	1
β-strand	51-66	16	6
β-strand	71-83	13	6
α-helix	85-87	3
β-strand	95-98	4	6
α-helix	100-102	3
β-strand	111-113	3	5
β-strand	116-121	6	6
β-strand	129-134	6	6
β-strand	138-150	13	6
β-strand	162-171	10	5
β-strand	179-190	12	6
β-strand	201-214	14	5
β-strand	219-231	13	5
α-helix	234-236	3
α-helix	237-241	5
α-helix	242-251	10
α-helix	253-256	4
α-helix	258	1
α-helix	262-280	19
α-helix	295-322	28
α-helix	375-378	4
α-helix	398-401	4
α-helix	402-426	25

Chain D: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	13-22	10
β-strand	39-54	16	7
β-strand	59-71	13	7
α-helix	73-75	3
β-strand	83-85	3	7
α-helix	88-91	4
β-strand	99-101	3	8
β-strand	104	1	7
β-strand	108-109	2	7
β-strand	117-122	6	7
β-strand	126-138	13	7
β-strand	150-159	10	8
β-strand	167-171	5	7
α-helix	175-178	4
β-strand	179-181	3	7
β-strand	186	1	7
β-strand	191-203	13	8
β-strand	210-221	12	8
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-243	12
α-helix	244-246	3
α-helix	252-275	24
α-helix	285-310	26
α-helix	387-390	4
α-helix	391-414	24

Chain E: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	10-20	11
α-helix	35	1
β-strand	36-47	12	9
β-strand	56-68	13	9
α-helix	70-72	3
β-strand	81-83	3	9
α-helix	85-90	6
β-strand	96-98	3	10
β-strand	101-106	6	9
β-strand	114-118	5	9
β-strand	123-135	13	9
β-strand	147-156	10	10
β-strand	164-168	5	9
α-helix	171-173	3
β-strand	175-176	2	9
β-strand	186-194	9	10
β-strand	197-199	3	11
β-strand	204-206	3	11
β-strand	207-216	10	10
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-237	11
α-helix	238-241	4
α-helix	247-271	25
α-helix	280-303	24
α-helix	304-308	5
α-helix	309-312	4
α-helix	422-446	25

Chain H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	673-695	23

Chain L: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	20-42	23
β-strand	47-48	2	12
β-strand	59	1	12
β-strand	64-66	3	12
β-strand	76-78	3	12
α-helix	90-112	23
α-helix	113-117	5
α-helix	121-145	25
α-helix	153-158	6
β-strand	164	1	13
β-strand	167	1	13
β-strand	172-173	2	12
α-helix	175-200	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit alpha-1	A, D	protein	405	Homo sapiens	P14867 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-3	B, E	protein	439	Homo sapiens	P28472 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	C	protein	411	Homo sapiens	P18507 (AlphaFold model)
Neuroligin-2	H	protein	29	Homo sapiens	Q8NFZ4 (AlphaFold model)
LHFPL tetraspan subfamily member 4 protein	L	protein	185	Homo sapiens	Q7Z7J7

Sequence of entity 1 (A, D), FASTA

>9RGE_1 Gamma-aminobutyric acid receptor subunit alpha-1 (chains A, D)
TTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWK
DERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTM
RLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQY
DLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRES
VPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFT
KRGYAWDGKSVVPEKPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPK
EVKPETKPPEPKKTFNSVSKIDRLSRIAFPLLFGIFNLVYWATYL

Sequence of entity 2 (B, E), FASTA

>9RGE_2 Gamma-aminobutyric acid receptor subunit beta-3 (chains B, E)
MSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWR
DKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGL
RITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSI
VEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASA
ARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFG
RGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAI
SFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSR
IVFPFTFSLFNLVYWLYYV

Sequence of entity 3 (C), FASTA

>9RGE_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains C)
VTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRR
LKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLT
IDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSFVGL
RNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPART
SLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSNRKP
SKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASF
FCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYLG

Sequence of entity 4 (H), FASTA

>9RGE_4 Neuroligin-2 (chains H)
DSRDYSTELSVTVAVGASLLFLNILAFAA

Sequence of entity 5 (L), FASTA

>9RGE_5 LHFPL tetraspan subfamily member 4 protein (chains L)
SRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFGLFHYCVGSGLAGRELTCR
GSFTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFSLFFFCNTATVYKICAWMQLLAALC
LVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILAIIGILNALILSFLAFVLG
NRQTD

Ligands and cofactors

ID	Name	Formula	Copies
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	2
PLM	Palmitic acid	C16 H32 O2	1
HEX	Hexane	C6 H14	5
PGW	(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexade…	C40 H77 O10 P	1
R16	Hexadecane	C16 H34	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1
P1L	S-palmitoyl-L-cysteine	C19 H37 N O3 S	3
D10	Decane	C10 H22	1
CLR	Cholesterol	C27 H46 O	1

Primary citation

CryoEM structure of human alpha1beta3gamma2 GABA(A)R in complex with GARLH4 and the TMD of Neuroligin2, in CL47a. Kasaragod, V.B., Aricescu, A.R. To be published.

Other PDB entries of the same protein (UniProt P14867 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RGD 2.0 Å, CryoEM structure of human alpha1beta3gamma2L GABA(A)R in CL47a
9EQG 2.4 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with GABA…
9FAS 2.5 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with…
9FFU 2.5 Å, Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in…
6X3T 2.55 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus propofol
8VRN 2.57 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus PPTQ
8PET 2.6 Å, Cryo-EM structure of the full-length human alpha1beta3 GABA(A) receptor (babba…
9FAJ 2.6 Å, CryoEM structure of human full-length alpha1beta3gamma2 GABA(A) receptor in complex with…
9FAK 2.6 Å, CryoEM structure of human full-length alpha1beta3gamma2 GABA(A) receptor in complex with…
9FGG 2.6 Å, Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in Saposin A…
8SGO 2.65 Å, Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus pregnenolone…
7QNE 2.7 Å, Cryo-EM structure of human full-length synaptic alpha1beta3gamma2 GABA(A)R in complex…

Browse structure collections

About this viewer

MolViewer shows 9RGE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.