9RO9: PDB entry 9RO9

Human alpha3 Na+,K+-ATPase in the Na+-bound E1-ATP state. Determined by electron microscopy at 3.27 Å resolution. Released 12 Aug 2026.

Method: Electron microscopy
Resolution: 3.27 Å
Organism: Homo sapiens
Chains: 3
Atoms: 10,301
Mol. weight: 160.28 kDa
Ligands: ATP, CLR, NAG, MG
Released: 12 Aug 2026

Explore 9RO9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9RO9 contains 62 α-helices and 49 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 51 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	38-44	7
α-helix	55-65	11
α-helix	71-73	3
α-helix	78-87	10
α-helix	92-107	16
α-helix	117	1
α-helix	118-122	5
α-helix	123-153	31
β-strand	158-163	6	1
β-strand	166-171	6	1
β-strand	180-184	5	1
β-strand	187-189	3	1
β-strand	192-205	14	1
β-strand	211-216	6	1
β-strand	232-233	2	1
β-strand	237-250	14	1
α-helix	252-254	3
α-helix	273-302	30
α-helix	307-320	14
α-helix	326-343	18
β-strand	346-347	2	2
α-helix	351-353	3
α-helix	354-358	5
β-strand	362-365	4	2
β-strand	377-383	7	3
β-strand	386-389	4	3
α-helix	406-418	13
β-strand	422-423	2	4
α-helix	424	1
α-helix	427-429	3
β-strand	437-438	2	4
α-helix	441-453	13
α-helix	457-463	7
β-strand	466-468	3	3
β-strand	481-483	3	3
β-strand	494-496	3	3
β-strand	499	1	3
α-helix	501-506	6
β-strand	510-513	4	3
β-strand	516-519	4	3
α-helix	522-537	16
β-strand	541-549	9	3
β-strand	574-582	9	3
α-helix	584-586	3
α-helix	589-598	10
β-strand	602-605	4	2
α-helix	611-621	11
β-strand	630	1	2
α-helix	631-638	8
α-helix	642-644	3
α-helix	647-649	3
β-strand	652-655	4	2
α-helix	657-661	5
α-helix	665-674	10
β-strand	677-680	4	2
α-helix	685-696	12
β-strand	702-706	5	2
α-helix	709-711	3
α-helix	712-717	6
β-strand	720-724	5	2
α-helix	730-735	6
β-strand	738-740	3	2
α-helix	745-771	27
α-helix	774-785	12
α-helix	794-804	11
α-helix	807-812	6
α-helix	815-817	3
α-helix	825-827	3
α-helix	837-840	4
α-helix	841-848	8
α-helix	849-866	18
α-helix	870-872	3
α-helix	877-881	5
β-strand	888-889	2	5
β-strand	895-896	2	5
α-helix	898-927	30
α-helix	934-937	4
α-helix	942-960	19
α-helix	964-967	4
α-helix	975-979	5
α-helix	982-1001	20
α-helix	1006-1011	6

Chain B: 10 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	29-60	32
α-helix	70-72	3
β-strand	76	1	6
β-strand	77-79	3	7
β-strand	87-89	3	8
α-helix	99-108	10
α-helix	116-118	3
β-strand	123-124	2	9
α-helix	125	1
α-helix	133-134	2
β-strand	148-149	2	9
α-helix	153-156	4
β-strand	177-180	4	7
β-strand	184	1	10
β-strand	208-210	3	11
β-strand	211-215	5	8
α-helix	218-224	7
β-strand	227	1	12
β-strand	230	1	7
β-strand	237-239	3	11
α-helix	240-242	3
α-helix	243-244	2
β-strand	245	1	10
β-strand	258-260	3	7
β-strand	263	1	12
β-strand	271-278	8	8
β-strand	292	1	6
β-strand	294-300	7	8

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	33-56	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium/potassium-transporting ATPase subunit alpha-3	A	protein	1013	Homo sapiens	P13637 (AlphaFold model)
Sodium/potassium-transporting ATPase subunit beta-1	B	protein	319	Homo sapiens	P05026 (AlphaFold model)
Phospholemman	C	protein	76	Homo sapiens	O00168 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9RO9_1 Sodium/potassium-transporting ATPase subunit alpha-3 (chains A)
MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
ILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNL
YLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDL
VEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCV
EGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILS
LILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGST
STICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNR
AVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQL
SIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGE
RVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAG
IKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDL
KDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADI
GVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPF
LLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLI
SMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQ
RKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSY
CPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGWVEKETYY

Sequence of entity 2 (B), FASTA

>9RO9_2 Sodium/potassium-transporting ATPase subunit beta-1 (chains B)
MARSHHHHHHHHHHPRRSRGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYG
CLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLN
IVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLND
ETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKV
GNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIG
YSEKDRFQGRFDVKIEVKS

Sequence of entity 3 (C), FASTA

>9RO9_3 Phospholemman (chains C)
GTKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEE
EGTFRSSIRRLSTRRR

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1
CLR	Cholesterol	C27 H46 O	3
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3
MG	Magnesium ion	Mg	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Active conformations of neuronal Na + , K + -ATPase isoforms and a disease-causing mutant. Christensen, M.E., Habeck, M., Katz, A. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-75997-4 · PubMed

Other PDB entries of the same protein (UniProt P13637 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9ROG 2.8 Å, Human alpha3 Na+,K+-ATPase in the Na+-occluded E1P-ADP state obtained under turnover…
9ROH 2.92 Å, Human alpha3 Na+,K+-ATPase in the Na+-occluded E2P state obtained under turnover…
9ROE 2.94 Å, Human alpha3 Na+,K+-ATPase in the outward open E2P state
9ROI 2.94 Å, Human alpha3 Na+,K+-ATPase in the K+-occluded E2P state obtained under turnover conditions
9ROA 3.08 Å, Human alpha3 Na+,K+-ATPase in the Na+-occluded E1P-ADP state
9ROD 3.12 Å, Human alpha3 Na+,K+-ATPase in the Na+-occluded E2P state
9ROF 3.27 Å, Human alpha3 Na+,K+-ATPase in the Na+-bound E1-ATP state obtained under turnover…
8D3V 3.4 Å, Human alpha3 Na+/K+-ATPase in its cytoplasmic side-open state
8D3W 3.5 Å, Human alpha3 Na+/K+-ATPase in its AMPPCP-bound cytoplasmic side-open state
9ROL 3.54 Å, Human alpha3 Q140L Na+,K+-ATPase in the Na+-occluded E2P state
9ROJ 3.58 Å, Human alpha3 Q140L Na+,K+-ATPase in the Na+-bound E1 state
9ROM 3.6 Å, Human alpha3 Q140L Na+,K+-ATPase in the outward open E2P state

Browse structure collections

About this viewer

MolViewer shows 9RO9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.