9RSM: NetF 9mer pre-pore structure on 2N2 nanodiscs

Name: PDB 9RSM: NetF 9mer pre-pore structure on 2N2 nanodiscs.
Published: 2026-02-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

NetF 9mer pre-pore structure on 2N2 nanodiscs. Determined by electron microscopy at 2.13 Å resolution. Released 18 Feb 2026.

Method: Electron microscopy
Resolution: 2.13 Å
Organism: Clostridium perfringens
Chains: 9
Atoms: 19,242
Mol. weight: 295.87 kDa
Released: 18 Feb 2026

Explore 9RSM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9RSM contains 45 α-helices and 207 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G, H and I: 5 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	24-34	11	1
β-strand	37-47	11	1
β-strand	51	1	2
β-strand	53-63	11	1
β-strand	64-65	2	3
β-strand	69-72	4	4
β-strand	76-92	17	4
β-strand	99-104	6	1
β-strand	109	1	4
β-strand	113-121	9	5
β-strand	125-129	5	5
α-helix	132-133	2
β-strand	142-150	9	5
β-strand	154-161	8	4
β-strand	165-172	8	4
β-strand	189	1	4
β-strand	194	1	6
α-helix	202-204	3
β-strand	206	1	6
α-helix	207-208	2
α-helix	209-211	3
α-helix	214-217	4
β-strand	219-220	2	3
β-strand	223-231	9	1
β-strand	236-253	18	4
β-strand	260-264	5	4
β-strand	270-279	10	4
β-strand	284-287	4	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leukocidin/Hemolysin toxin family	A, B, C, D, E, F, G, H, I	protein	289	Clostridium perfringens	A0A0D3QGV4 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I), FASTA

>9RSM_1 Leukocidin/Hemolysin toxin family (chains A, B, C, D, E, F, G, H, I)
MVHHHHHHNSFPESIINSKGKQAEVYTSSDASERDGIKTSLSASFIEDPNSNNLTALVSL
KGFIPSGLIKTGTYYSANMYWPSKYNINIETTDEKNNVKILESIPSNTIETVRVTESMGY
SIGGNVSVSKKSSSVGANAGFNVQRSVQYEQPDFKTIQKSDGIRKASWNIVFNKTKDGYD
QNSYHALYGNQLFMKSRLHNTGAKNLVEDKDLSPLISGGFTPNMVIALKAPKGTKKSMIN
LNYNLYQDLYTLEWYKTQWWGENRVAKEPYYTYQTYELDWENHTVEFIY

Primary citation

Identification and structural characterization of anthrax toxin receptor 2 as the Clostridium perfringens NetF receptor. Wang, C., Cattalani, F., Iacovache, I. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-69526-6 · PubMed

Other PDB entries of the same protein (UniProt A0A0D3QGV4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RSU 2.1 Å, NetF pore structure
9RT2 2.6 Å, NetF - ANTXR2 structure (C4)
9RT4 2.6 Å, NetF - ANTXR2 local refinement focused

Browse structure collections

About this viewer

MolViewer shows 9RSM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.