9RUG: LB_DQB0303_A Heavy chain

Cryo-EM structure of the LB_DQB0303_A Fab - HLA-DQB1*03:03/DQA1*02:01 human alloantibody-HLA complex. Determined by electron microscopy at 2.74 Å resolution. Released 15 Jul 2026.

Method: Electron microscopy
Resolution: 2.74 Å
Organism: Homo sapiens
Chains: 5
Atoms: 5,862
Mol. weight: 97.34 kDa
Released: 15 Jul 2026

Explore 9RUG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9RUG contains 16 α-helices and 65 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	7-17	11	10
β-strand	22-29	8	10
β-strand	32-38	7	10
β-strand	43-46	4	10
α-helix	49-52	4
α-helix	58-78	21
α-helix	83-85	3
β-strand	90-95	6	13
β-strand	105-112	8	13
β-strand	120-125	6	14
β-strand	128-130	3	14
β-strand	134-136	3	13
β-strand	140-141	2	15
β-strand	147-148	2	15
β-strand	149-155	7	13
β-strand	163-168	6	14
β-strand	176-180	5	14

Chain B: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	8-18	11	10
β-strand	23-32	10	10
β-strand	35-41	7	10
β-strand	47-49	3	10
α-helix	54-63	10
α-helix	65-74	10
α-helix	75-80	6
α-helix	81-89	9
α-helix	96-97	2
β-strand	98-103	6	11
β-strand	114-120	7	11
β-strand	128-133	6	12
β-strand	136-137	2	12
β-strand	142-144	3	11
α-helix	145-147	3
β-strand	148-149	2	11
β-strand	155-162	8	11
β-strand	171-176	6	12
β-strand	184	1	12

Chain H: 4 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	1
β-strand	11-12	2	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	3
β-strand	45-51	7	3
β-strand	58-60	3	3
α-helix	62-64	3
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-99	8	3
α-helix	100	1
β-strand	109-111	3	3
β-strand	114	1	1
β-strand	116-118	3	3
β-strand	119-120	2	2
β-strand	129-131	3	4
β-strand	145-154	10	4
β-strand	162-163	2	5
β-strand	172-174	3	4
β-strand	185-193	9	4
β-strand	204-209	6	5
β-strand	214-219	6	5

Chain L: 3 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	6
β-strand	10-13	4	7
β-strand	19-25	7	6
β-strand	33-38	6	7
β-strand	45-49	5	7
β-strand	53-54	2	7
α-helix	55	1
β-strand	62-67	6	6
β-strand	70-75	6	6
α-helix	80-82	3
β-strand	85-90	6	7
β-strand	98	1	7
β-strand	103-107	5	7
α-helix	113-114	2
β-strand	115-118	4	8
β-strand	131-140	10	8
β-strand	146-150	5	9
β-strand	160-164	5	8
β-strand	174-182	9	8
β-strand	193-198	6	9
β-strand	206-210	5	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
LB_DQB0303_A Heavy chain	H	protein	238	Homo sapiens
LB_DQB0303_A Light chain	L	protein	215	Homo sapiens
Lymphocyte antigen	B	protein	185	Homo sapiens	Q29967 (AlphaFold model)
HLA class II histocompatibility antigen DQ alpha chain	A	protein	229	Homo sapiens	Q08AS3 (AlphaFold model)
Peptide, unknown sequence	P	protein	12	Homo sapiens

Sequence of entity 1 (H), FASTA

>9RUG_1 LB_DQB0303_A Heavy chain (chains H)
EVQLVESGGGLVQPGGSLRLSCAASGFTLSTYEMNWVRQAPGKGLEWVSYSSRSGGNRFY
ADSVKGRFTISRDNAKNSLFLQMNSLRVEDTAVYYCARDHAHIEATGPLDCWGLGTLVTV
SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHHHHHH

Sequence of entity 2 (L), FASTA

>9RUG_2 LB_DQB0303_A Light chain (chains L)
DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKILIYDASSLETGVPS
RFSGSGSGTEFTLTISSLQPDDFATYYCQQYFSYPGFTFGPGTKVDIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (B), FASTA

>9RUG_3 Lymphocyte antigen (chains B)
RDSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPDAEY
WNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVT
DFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSL
QNPII

Sequence of entity 4 (A), FASTA

>9RUG_4 HLA class II histocompatibility antigen DQ alpha chain (chains A)
EDIVADHVASYGVNLYQSYGPSGQFTHEFDGDEEFYVDLERKETVWKLPLFHRLRFDPQF
ALTNIAVLKHNLNILIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVN
ITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHW
EPEIPAPMSELTETVVCALGLSVGLVGIVVGTVLIIRGLRSVGASRHQG

Sequence of entity 5 (P), FASTA

>9RUG_5 Peptide, unknown sequence (chains P)
XXXXXXXXXXXX

Primary citation

Cryo-EM structure of the LB_DQB0303_A Fab - HLA-DQB1*03:03/DQA1*02:01 human alloantibody-HLA complex. Zampieri, V., Priddey, A., Linares, R. et al. To be published.

Browse structure collections

About this viewer

MolViewer shows 9RUG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.