9RXT: PDB entry 9RXT

Structure of the PDZ1 domain from human NHERF1 with the C-terminal residues (NATRL) of the human sodium-dependent phosphate transporter 2A (NaPi-IIa, SLC34A1). Determined by X-ray diffraction at 1.36 Å resolution. Released 14 Jan 2026.

Method: X-ray diffraction
Resolution: 1.36 Å
Organism: Homo sapiens
Chains: 1
Atoms: 907
Mol. weight: 9.95 kDa
Ligands: TOE
Released: 14 Jan 2026

Explore 9RXT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9RXT contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	1
β-strand	20	1	2
β-strand	23	1	2
β-strand	26-29	4	1
β-strand	38-42	5	1
α-helix	47-50	4
β-strand	58-62	5	1
β-strand	65-66	2	1
α-helix	72-81	10
β-strand	85-91	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Na(+)/H(+) exchange regulatory cofactor NHE-RF1,Sodium-dependent phosphate transport protein 2A	A	protein	90	Homo sapiens	O14745 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9RXT_1 Na(+)/H(+) exchange regulatory cofactor NHE-RF1,Sodium-dependent phosphate transport protein 2A (chains A)
GLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEK
ETHQQVVSRIRAALNAVRLLVVDPENATRL

Ligands and cofactors

ID	Name	Formula	Copies
TOE	2-[2-(2-methoxy-ethoxy)-ethoxy]-ethoxyl	C7 H16 O4	1

Primary citation

Molecular Determinants of Selective and High-affinity Binding of the Scaffold Protein PDZK1 to the Urate Transporter URAT1. Mymrikov, E.V., Wirth, C., Heinicke, J.I. et al. J Mol Biol (2025) 438:169615-169615. DOI 10.1016/j.jmb.2025.169615 · PubMed

Other PDB entries of the same protein (UniProt O14745 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N6X 1.05 Å, Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain…
4MPA 1.1 Å, Crystal structure of NHERF1-CXCR2 signaling complex in P21 space group
4LMM 1.1 Å, Crystal structure of NHERF1 PDZ1 domain complexed with the CXCR2 C-terminal tail in P21…
4JL7 1.16 Å, Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain…
9RXQ 1.38 Å, Structure of the PDZ1 domain from human NHERF1 with the C-terminal residues (KSTQF) of…
4Q3H 1.44 Å, The crystal structure of NHERF1 PDZ2 CXCR2 complex revealed by the NHERF1 CXCR2 chimeric…
4PQW 1.47 Å, Crystal Structure of Phospholipase C beta 3 in Complex with PDZ1 of NHERF1
1G9O 1.5 Å, First PDZ domain of the human na+/h+ exchanger regulatory factor
2OZF 1.5 Å, The crystal structure of the 2nd PDZ domain of the human NHERF-1 (SLC9A3R1)
1I92 1.7 Å, Structural basis of the nherf PDZ1-cftr interaction
1GQ5 2.2 Å, Structural Determinants of the NHERF Interaction with beta2-AR and PDGFR
6RQR 2.2 Å, Extended NHERF1 PDZ2 domain in complex with the PDZ-binding motif of CFTR

Browse structure collections

About this viewer

MolViewer shows 9RXT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.