9SLO: WD repeat-containing protein 5

WD repeat containing protein 5 (WDR5)- PER1 peptide. Determined by X-ray diffraction at 1.7 Å resolution. Released 16 Sept 2026.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,577
Mol. weight: 36.35 kDa
Released: 16 Sept 2026

Explore 9SLO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9SLO contains 2 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 28 β-strands

Element	Residues	Length	Sheet
β-strand	36-41	6	1
β-strand	48-53	6	2
β-strand	59-64	6	2
β-strand	69-73	5	2
β-strand	79-83	5	2
β-strand	90-95	6	3
β-strand	101-106	6	3
β-strand	111-115	5	3
β-strand	121-125	5	3
β-strand	132-137	6	4
β-strand	143-148	6	4
β-strand	153-157	5	4
β-strand	163-167	5	4
β-strand	174-179	6	5
β-strand	185-190	6	5
β-strand	195-199	5	5
β-strand	205-209	5	5
α-helix	215-216	2
β-strand	217-222	6	6
β-strand	228-233	6	6
β-strand	237-242	6	6
β-strand	247-252	6	6
β-strand	264-267	4	7
β-strand	273-276	4	7
β-strand	283-287	5	7
β-strand	293-297	5	7
β-strand	304-309	6	1
β-strand	315-320	6	1
β-strand	327-331	5	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1110-1112	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
WD repeat-containing protein 5	A	protein	315	Mus musculus	P61965 (AlphaFold model)
Period circadian protein homolog 1	B	protein	14	Mus musculus	O35973 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9SLO_1 WD repeat-containing protein 5 (chains A)
GPSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKF
EKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNP
QSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWD
TASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEK
YCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASA
ALENDKTIKLWKSDC

Sequence of entity 2 (B), FASTA

>9SLO_2 Period circadian protein homolog 1 (chains B)
EAGAARARTEPGDQ

Primary citation

Structure of PER1/WDR5 complex. Hof, F., Emelianov, M., Dekorsy, H.T. et al. To be published.

Other PDB entries of the same protein (UniProt P61965 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8OK1 1.38 Å, WD repeat containing protein 5 (WDR5)- N225A mutant
8OKF 1.85 Å, WD repeat containing protein 5 (WDR5)- PER2 peptide
2XL2 2.4 Å, WDR5 in complex with an RBBP5 peptide recruited to novel site
8YDD 2.5 Å, Crystal structure of Nanog(R100A) in complex with Wdr5
2XL3 2.7 Å, WDR5 in complex with an RBBP5 peptide and histone H3 peptide

Browse structure collections

About this viewer

MolViewer shows 9SLO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.