9SO8: Glucose/ xylose isomerase under 100 MPa

Name: PDB 9SO8: Glucose/ xylose isomerase under 100 MPa
Published: 2026-09-30
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: isomerase

Glucose/ xylose isomerase under 100 MPa. Determined by X-ray diffraction at 1.09 Å resolution. Released 30 Sept 2026.

Method: X-ray diffraction
Resolution: 1.09 Å
Organism: Streptomyces pseudogriseolus
Chains: 1
Atoms: 4,328
Mol. weight: 43.67 kDa
Ligands: MN, MG
Released: 30 Sept 2026

Explore 9SO8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9SO8 contains 22 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	11-14	4	1
α-helix	15-18	4
β-strand	24	1	2
β-strand	27	1	2
α-helix	36-45	10
β-strand	50-52	3	1
β-strand	53-54	2	3
α-helix	55-58	4
α-helix	65-82	18
β-strand	85	1	1
β-strand	88-90	3	3
α-helix	97-99	3
α-helix	109-128	20
β-strand	133-136	4	3
β-strand	142-143	2	4
α-helix	146-148	3
α-helix	151-171	21
β-strand	177-180	4	3
β-strand	190-191	2	4
α-helix	196-203	8
α-helix	209-211	3
β-strand	212-214	3	3
β-strand	217	1	1
α-helix	218-222	5
α-helix	228-237	10
β-strand	241	1	3
β-strand	245-246	2	1
β-strand	248	1	5
β-strand	258	1	5
α-helix	259	1
β-strand	260	1	6
β-strand	262	1	6
α-helix	265-278	14
β-strand	284-286	3	1
α-helix	296-322	27
α-helix	324-332	9
α-helix	335-338	4
α-helix	347-351	5
α-helix	354-356	3
α-helix	362-367	6
α-helix	372-384	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Xylose isomerase	A	protein	386	Streptomyces pseudogriseolus	P24300 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9SO8_1 Xylose isomerase (chains A)
NYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVESVRRLAELGAHGVTFHDDDLIPF
GSSDSEREEHVKRFRQALDDTGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTIR
NIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKEAFDLLGEYVTSQGYDIRFAIE
PKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGKL
FHIDLNGQNGIKYDQDLRFGAGDLRAAFWLVDLLESAGYSGPRHFDFKPPRTEDFDGVWA
SAAGCMRNYLILKERAAAFRADPEVQEALRASRLDELARPTAADGLQALLDDRSAFEEFD
VDAAAARGMAFERLDQLAMDHLLGAR

Ligands and cofactors

ID	Name	Formula	Copies
MN	Manganese (II) ion	Mn	2
MG	Magnesium ion	Mg	4

Water and common crystallization additives (GOL) are not listed.

Primary citation

Glucose/ xylose isomerase under 100 MPa. Klonecka, A., Slawek, J., Kurpiewska, K. et al. To be published.

Other PDB entries of the same protein (UniProt P24300 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AVH 0.9 Å, The 0.90 angstrom structure (I222) of glucose isomerase crystallized in high-strength…
2GLK 0.94 Å, High-resolution study of D-Xylose isomerase, 0.94A resolution.
4A8I 0.95 Å, Protein crystallization and microgravity: glucose isomerase crystals grown during the…
3U3H 0.97 Å, X-Ray Crystallographic Analysis of D-Xylose Isomerase-Catalyzed Isomerization of…
1MNZ 0.99 Å, Atomic structure of Glucose isomerase
7DMM 0.99 Å, Structure of a glucose isomerase crystal grown in an aqueous glycerol solution without…
8WDG 0.99 Å, Subatomic crystal structure of glucose isomerase from Streptomyces rubiginosus
5AVN 1.03 Å, The 1.03 angstrom structure (P212121) of glucose isomerase crystallized in high-strength…
6YBO 1.06 Å, RT structure of Glucose Isomerase obtained at 1.06 A resolution from crystal grown in a…
6QRR 1.1 Å, X-ray radiation dose series on xylose isomerase - 0.13 MGy
6QRS 1.17 Å, X-ray radiation dose series on xylose isomerase - 0.13 MGy
6QRT 1.17 Å, X-ray radiation dose series on xylose isomerase - 1.38 MGy

Browse structure collections

About this viewer

MolViewer shows 9SO8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.