9SR0: Vinculin

Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with mouse talin 1 helix 50 (H50, residues 2072-2103). Determined by X-ray diffraction at 1.49 Å resolution. Released 20 May 2026.

Method: X-ray diffraction
Resolution: 1.49 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,484
Mol. weight: 32.36 kDa
Released: 20 May 2026

Explore 9SR0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9SR0 contains 10 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
α-helix	7-26	20
α-helix	36-39	4
α-helix	41-64	24
α-helix	68-97	30
α-helix	102-145	44
α-helix	148-150	3
α-helix	154-181	28
β-strand	182	1	1
α-helix	185-214	30
α-helix	224-248	25

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2078-2101	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vinculin	A	protein	260	Mus musculus	Q64727 (AlphaFold model)
Talin-1	B	protein	33	Mus musculus	P26039 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9SR0_1 Vinculin (chains A)
GGSPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAIVSNLVRVG
KETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSG
TSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDER
QQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMS
AEINEIIRVLQLTSWDEDAW

Sequence of entity 2 (B), FASTA

>9SR0_2 Talin-1 (chains B)
CEDPETQVVLINAVKDVAKALGDLISATKAAAG

Primary citation

Talin controls the spatial distribution of vinculin tension in focal adhesions. Kallem, T., Guo, Y., Reynolds, M.K. et al. bioRxiv (2026). DOI 10.64898/2026.05.07.722930

Other PDB entries of the same protein (UniProt Q64727 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5Y04 2.85 Å, Crystal Structure of the complex between the vinculin D1 domain and alphaE-catenin

Browse structure collections

About this viewer

MolViewer shows 9SR0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.