9T5S: Human PPARalpha

Crystal structure of human PPARalpha in complex with co-activator PGC-1 alpha peptide and bempedoic acid. Determined by X-ray diffraction at 1.74 Å resolution. Released 17 Dec 2025.

Method: X-ray diffraction
Resolution: 1.74 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,960
Mol. weight: 70.31 kDa
Ligands: A1JTY
Released: 17 Dec 2025

Explore 9T5S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9T5S contains 37 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	201-217	17
α-helix	222-230	9
α-helix	237-238	2
β-strand	239-241	3	1
α-helix	244-253	10
α-helix	255-260	6
α-helix	268-292	25
α-helix	297-299	3
α-helix	302-321	20
α-helix	322-324	3
β-strand	325-326	2	1
β-strand	329-332	4	1
β-strand	337-340	4	1
α-helix	341-346	6
α-helix	348	1
α-helix	352-367	16
α-helix	372-383	12
α-helix	394-415	22
α-helix	422-450	29
α-helix	458-464	7

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	689-695	7
α-helix	697-698	2

Chain C: 18 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	201-217	17
α-helix	222-230	9
α-helix	237-238	2
β-strand	239-241	3	2
α-helix	244-253	10
α-helix	255-260	6
α-helix	268-292	25
α-helix	297-299	3
α-helix	302-321	20
α-helix	322-324	3
β-strand	325-326	2	2
β-strand	329-332	4	2
β-strand	337-340	4	2
α-helix	341-346	6
α-helix	348	1
α-helix	351-353	3
α-helix	356-366	11
α-helix	372-383	12
α-helix	394-415	22
α-helix	422-450	29
α-helix	455-457	3
α-helix	458-464	7

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	689-694	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peroxisome proliferator-activated receptor alpha	A, C	protein	290	Homo sapiens	Q07869 (AlphaFold model)
Peroxisome proliferator-activated receptor gamma coactivator 1-alpha	B, D	protein	19	Homo sapiens	Q9UBK2 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>9T5S_1 Peroxisome proliferator-activated receptor alpha (chains A, C)
MGSSHHHHHHSSGLVPRGSHMTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPP
FVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFA
NLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPK
FDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPD
DIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY

Sequence of entity 2 (B, D), FASTA

>9T5S_2 Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (chains B, D)
QEAEEPSLLKKLLLAPANT

Ligands and cofactors

ID	Name	Formula	Copies
A1JTY	Bempedoic acid	C19 H36 O5	2

Primary citation

Bempedoic acid directly binds and activates PPAR alpha. Papa, C., Rose, A., Martin, H.N.G. et al. Cell Metab (2026) 38:824. DOI 10.1016/j.cmet.2025.12.018 · PubMed

Other PDB entries of the same protein (UniProt Q07869 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KAX 1.23 Å, X-ray structure of human PPARalpha ligand binding domain-intrinsic fatty acid (E. coli…
6LXA 1.23 Å, X-ray structure of human PPARalpha ligand binding domain-eicosapentaenoic acid (EPA)…
6KB1 1.25 Å, X-ray structure of human PPARalpha ligand binding domain-tetradecylthioacetic acid (TTA)…
6LX6 1.3 Å, X-ray structure of human PPARalpha ligand binding domain-palmitic acid co-crystals…
6KB0 1.35 Å, X-ray structure of human PPARalpha ligand binding domain-5,8,11,14-eicosatetraynoic acid…
9IWM 1.39 Å, X-ray structure of human PPARalpha ligand binding domain-GW7647-TRAP220 coactivator…
6LX9 1.4 Å, X-ray structure of human PPARalpha ligand binding domain-arachidonic acid co-crystals…
6LX7 1.41 Å, X-ray structure of human PPARalpha ligand binding domain-stearic acid co-crystals…
6KB4 1.42 Å, X-ray structure of human PPARalpha ligand binding domain-pemafibrate co-crystals…
6KB6 1.43 Å, X-ray structure of human PPARalpha ligand binding domain-tetradecylthioacetic acid (TTA)…
6KB3 1.45 Å, X-ray structure of human PPARalpha ligand binding domain-GW7647 co-crystals obtained by…
9VZS 1.46 Å, X-ray structure of human PPARalpha ligand binding domain-10-hydroxystearic acid (10-HSA)…

Browse structure collections

About this viewer

MolViewer shows 9T5S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.