9T8H: Murine RNF213

Murine RNF213 bound to maltoheptaose. Determined by electron microscopy at 3.0 Å resolution. Released 23 Sept 2026.

Method: Electron microscopy
Resolution: 3.0 Å
Organism: Mus musculus
Chains: 1
Atoms: 36,555
Mol. weight: 590.59 kDa
Ligands: ZN, ATP
Released: 23 Sept 2026

Explore 9T8H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9T8H contains 285 α-helices and 116 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 285 helices, 116 β-strands

Element	Residues	Length	Sheet
β-strand	347-356	10	1
β-strand	368-373	6	2
α-helix	375-377	3
β-strand	387	1	2
β-strand	388-393	6	1
α-helix	395-397	3
β-strand	399-408	10	1
α-helix	409-411	3
β-strand	416-423	8	2
β-strand	432-434	3	2
β-strand	449-452	4	2
α-helix	456-458	3
β-strand	463-471	9	1
α-helix	489-510	22
α-helix	511-513	3
α-helix	518-535	18
β-strand	539-542	4	2
β-strand	544-547	4	2
α-helix	549-551	3
α-helix	555-574	20
α-helix	579-581	3
α-helix	591-604	14
α-helix	611-621	11
α-helix	623-624	2
α-helix	628-634	7
α-helix	636-641	6
α-helix	642-658	17
α-helix	663-667	5
α-helix	668-673	6
α-helix	677-680	4
α-helix	689-693	5
α-helix	700-704	5
α-helix	712-719	8
α-helix	721-725	5
α-helix	730-735	6
α-helix	740-749	10
α-helix	751-756	6
α-helix	758-760	3
α-helix	761-769	9
α-helix	781-801	21
α-helix	802-806	5
α-helix	811-828	18
α-helix	832-834	3
α-helix	836-850	15
α-helix	864-888	25
β-strand	894-896	3	3
β-strand	901-903	3	3
α-helix	908-916	9
α-helix	922-924	3
α-helix	926-939	14
α-helix	943-951	9
α-helix	953-955	3
α-helix	963-981	19
α-helix	995-1009	15
β-strand	1012	1	4
β-strand	1017	1	4
α-helix	1021-1030	10
α-helix	1033-1043	11
α-helix	1046-1050	5
α-helix	1053-1075	23
β-strand	1079	1	5
α-helix	1080-1088	9
α-helix	1090-1102	13
α-helix	1113-1143	31
β-strand	1149-1150	2	6
α-helix	1154-1160	7
β-strand	1167	1	5
β-strand	1173	1	7
β-strand	1183	1	7
α-helix	1191-1203	13
α-helix	1207-1221	15
β-strand	1231-1232	2	6
α-helix	1234-1237	4
α-helix	1238-1242	5
α-helix	1243-1258	16
β-strand	1262	1	8
α-helix	1263-1269	7
α-helix	1270-1273	4
α-helix	1277-1288	12
α-helix	1296-1329	34
α-helix	1336-1338	3
α-helix	1339-1351	13
β-strand	1355	1	8
α-helix	1361-1367	7
α-helix	1369-1372	4
α-helix	1375-1386	12
α-helix	1388-1397	10
α-helix	1401-1414	14
α-helix	1419-1434	16
α-helix	1436-1439	4
α-helix	1448-1463	16
α-helix	1468-1477	10
α-helix	1479-1483	5
α-helix	1496-1506	11
β-strand	1508-1511	4	9
α-helix	1518-1520	3
α-helix	1522-1525	4
β-strand	1526-1531	6	9
β-strand	1540-1543	4	9
α-helix	1545-1557	13
α-helix	1559-1560	2
α-helix	1564-1592	29
β-strand	1602-1606	5	9
β-strand	1612-1616	5	9
β-strand	1625-1627	3	9
α-helix	1631-1659	29
α-helix	1662-1665	4
α-helix	1668-1678	11
α-helix	1685-1691	7
α-helix	1700-1710	11
α-helix	1713-1731	19
α-helix	1736-1749	14
α-helix	1751-1754	4
α-helix	1761-1773	13
β-strand	1780	1	10
α-helix	1782-1784	3
β-strand	1791	1	11
β-strand	1794-1797	4	11
α-helix	1799-1810	12
α-helix	1817-1819	3
β-strand	1824-1826	3	11
α-helix	1833-1844	12
β-strand	1851	1	10
β-strand	1853-1857	5	11
α-helix	1859-1861	3
α-helix	1864-1878	15
β-strand	1887-1893	7	11
α-helix	1894-1896	3
α-helix	1900-1904	5
α-helix	1906-1908	3
β-strand	1909	1	11
α-helix	1913-1914	2
α-helix	1918-1929	12
α-helix	1938-1940	3
β-strand	1948-1953	6	12
α-helix	1960-1975	16
β-strand	1982-1987	6	12
β-strand	1991	1	13
α-helix	1994-2001	8
α-helix	2002-2004	3
α-helix	2007-2011	5
β-strand	2015-2020	6	12
β-strand	2026	1	13
α-helix	2028-2032	5
α-helix	2033-2037	5
β-strand	2040-2042	3	14
β-strand	2048-2050	3	14
β-strand	2056-2062	7	12
α-helix	2080-2085	6
β-strand	2090-2092	3	12
α-helix	2096-2102	7
α-helix	2117-2121	5
α-helix	2123-2136	14
α-helix	2155-2165	11
α-helix	2173-2192	20
α-helix	2208-2219	12
α-helix	2221-2224	4
β-strand	2266-2269	4	15
β-strand	2276-2279	4	15
β-strand	2282-2285	4	16
β-strand	2290	1	17
β-strand	2291-2294	4	16
β-strand	2301-2303	3	16
β-strand	2308	1	17
α-helix	2309-2317	9
α-helix	2326-2328	3
α-helix	2331-2342	12
α-helix	2358-2373	16
β-strand	2377-2380	4	18
α-helix	2387-2399	13
β-strand	2408-2411	4	18
α-helix	2418-2438	21
β-strand	2443-2448	6	18
α-helix	2450-2452	3
α-helix	2456-2460	5
α-helix	2461-2465	5
β-strand	2467-2468	2	19
β-strand	2471-2472	2	19
α-helix	2473-2474	2
β-strand	2479-2485	7	18
β-strand	2490	1	20
α-helix	2491-2492	2
α-helix	2493-2500	8
β-strand	2516-2517	2	21
β-strand	2520-2521	2	21
α-helix	2522-2524	3
β-strand	2525	1	20
α-helix	2531-2533	3
β-strand	2541-2542	2	18
α-helix	2548-2562	15
α-helix	2570-2587	18
α-helix	2599-2614	16
α-helix	2616-2630	15
α-helix	2633-2636	4
α-helix	2641-2650	10
α-helix	2651-2655	5
α-helix	2661-2669	9
α-helix	2679-2696	18
α-helix	2698-2699	2
α-helix	2707-2722	16
α-helix	2724-2725	2
β-strand	2726-2730	5	22
α-helix	2737-2746	10
β-strand	2748	1	22
α-helix	2749-2751	3
α-helix	2755-2758	4
β-strand	2762-2769	8	22
α-helix	2776-2790	15
β-strand	2798-2805	8	22
α-helix	2807-2810	4
α-helix	2817-2820	4
α-helix	2821-2827	7
α-helix	2836-2838	3
β-strand	2841-2846	6	22
α-helix	2852-2855	4
β-strand	2859-2863	5	22
α-helix	2864-2866	3
α-helix	2868-2879	12
α-helix	2883-2889	7
α-helix	2890-2892	3
α-helix	2893-2905	13
α-helix	2914-2931	18
α-helix	2937-2948	12
α-helix	2956-2962	7
α-helix	2965-2967	3
α-helix	2975-2983	9
α-helix	3000-3001	2
β-strand	3002-3006	5	23
α-helix	3011-3014	4
α-helix	3015-3019	5
α-helix	3024-3025	2
β-strand	3026-3028	3	23
α-helix	3038-3055	18
β-strand	3059-3061	3	23
α-helix	3064-3076	13
β-strand	3087-3092	6	24
β-strand	3095-3100	6	24
β-strand	3107-3112	6	23
α-helix	3113-3118	6
α-helix	3122-3127	6
β-strand	3129-3132	4	23
α-helix	3135-3138	4
α-helix	3141-3158	18
β-strand	3160	1	25
α-helix	3173-3176	4
β-strand	3177	1	26
β-strand	3179	1	27
α-helix	3184-3194	11
α-helix	3203-3218	16
β-strand	3221	1	26
α-helix	3223-3228	6
α-helix	3229-3231	3
β-strand	3232	1	25
α-helix	3236-3244	9
α-helix	3245-3249	5
α-helix	3255-3262	8
β-strand	3272-3279	8	28
α-helix	3282-3284	3
α-helix	3286-3295	10
β-strand	3304-3307	4	28
α-helix	3314-3326	13
β-strand	3331-3339	9	28
α-helix	3346-3348	3
α-helix	3350-3363	14
β-strand	3370-3378	9	28
α-helix	3384-3387	4
β-strand	3389	1	27
β-strand	3396-3400	5	28
β-strand	3410	1	29
α-helix	3414-3418	5
α-helix	3422-3425	4
α-helix	3471-3474	4
β-strand	3475	1	29
α-helix	3477-3490	14
β-strand	3492-3494	3	30
α-helix	3502-3512	11
α-helix	3518-3539	22
α-helix	3544-3547	4
α-helix	3549-3555	7
α-helix	3557-3563	7
α-helix	3566-3589	24
α-helix	3591-3593	3
α-helix	3596-3599	4
α-helix	3605-3615	11
β-strand	3636	1	31
β-strand	3639-3641	3	30
α-helix	3647-3648	2
α-helix	3658-3675	18
α-helix	3681-3689	9
α-helix	3693-3699	7
α-helix	3703-3721	19
α-helix	3727-3746	20
α-helix	3762-3770	9
α-helix	3772-3784	13
α-helix	3788-3792	5
α-helix	3808-3822	15
α-helix	3829-3847	19
α-helix	3849-3852	4
α-helix	3857-3879	23
α-helix	3880-3884	5
α-helix	3885-3889	5
α-helix	3892-3894	3
α-helix	3895-3910	16
α-helix	3918-3939	22
β-strand	3957-3960	4	32
β-strand	3964-3967	4	32
α-helix	3968-3972	5
β-strand	3981	1	33
β-strand	3988	1	33
α-helix	3999-4022	24
α-helix	4023-4027	5
α-helix	4036-4046	11
β-strand	4047	1	34
α-helix	4048-4050	3
β-strand	4064	1	34
β-strand	4075	1	34
β-strand	4079-4081	3	35
α-helix	4083-4089	7
α-helix	4093-4110	18
α-helix	4118-4138	21
α-helix	4143-4156	14
α-helix	4172-4195	24
α-helix	4200-4202	3
α-helix	4203-4218	16
α-helix	4222-4244	23
α-helix	4250-4254	5
α-helix	4257-4262	6
α-helix	4272-4276	5
α-helix	4278-4293	16
α-helix	4297-4305	9
α-helix	4310-4321	12
α-helix	4322-4326	5
α-helix	4327-4329	3
α-helix	4343-4352	10
α-helix	4359-4370	12
α-helix	4374-4377	4
α-helix	4383-4402	20
α-helix	4406-4408	3
α-helix	4409-4415	7
α-helix	4418-4421	4
β-strand	4449-4450	2	36
β-strand	4456-4457	2	36
β-strand	4503	1	37
α-helix	4512-4515	4
α-helix	4523-4543	21
α-helix	4545-4551	7
β-strand	4552	1	37
α-helix	4559-4578	20
α-helix	4582-4598	17
α-helix	4614-4633	20
α-helix	4635-4647	13
α-helix	4650-4653	4
α-helix	4656-4661	6
α-helix	4673-4674	2
α-helix	4687-4690	4
α-helix	4692-4701	10
α-helix	4704-4707	4
α-helix	4709-4716	8
α-helix	4718-4721	4
α-helix	4722-4726	5
α-helix	4727-4741	15
β-strand	4751	1	38
α-helix	4752-4758	7
α-helix	4762-4788	27
β-strand	4808	1	38
α-helix	4809-4811	3
α-helix	4818-4820	3
α-helix	4821-4845	25
β-strand	4852-4854	3	39
α-helix	4855-4857	3
α-helix	4860-4862	3
α-helix	4868-4872	5
α-helix	4873-4878	6
β-strand	4880-4885	6	35
β-strand	4890-4894	5	35
α-helix	4896-4903	8
α-helix	4904-4908	5
β-strand	4913-4915	3	39
β-strand	4928	1	31
α-helix	4930-4940	11
α-helix	4945-4947	3
α-helix	4948-4957	10
α-helix	4961-4981	21
β-strand	4988	1	40
α-helix	4989-4991	3
α-helix	4992-4996	5
α-helix	5004-5009	6
α-helix	5010-5012	3
β-strand	5014	1	40
α-helix	5015-5017	3
α-helix	5018-5035	18
α-helix	5046-5048	3
α-helix	5050-5053	4
α-helix	5054-5064	11
α-helix	5069-5082	14
β-strand	5098	1	41
α-helix	5099-5109	11
α-helix	5115-5121	7
β-strand	5127	1	41
α-helix	5128-5130	3
α-helix	5131-5147	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase RNF213	B	protein	5188	Mus musculus	E9Q555

Sequence of entity 1 (B), FASTA

>9T8H_1 E3 ubiquitin-protein ligase RNF213 (chains B)
MASWSHPQFEKGSAGSAAGSGAGWSHPQFEKENLYFQAMSMECPQCGHVSSEKAPKFCSE
CGQKLPSAATVQGDLKNDNTLVVSSTPEGKTEQGAVLREEEVLLSSTDPGKELEKPEESD
SNASWTTQMSKKEKRRRKRQGTISSSEAPSSGLWSLDMPPSPGSHNSALPQNQAQQGGAA
SQPGHPLDTENMPMEDGFVHTEGSGSPLQGQAAERTDAQSNLAPSDLAEVKDLNTSKPSV
DKGLPLDGGPALSAFKGHPKMTDASQKAPLPESKGETSGQEKKVPPIDAAASPVKTAGKE
TGEDVRKPKPSPVSPVASKHGDQEAELKGKLATPVRKSNEGGNTQPEDQRKPGEGRNFAA
AVKTQQAAAPQQAAAPEPTSAFNPRDTVTVYFHAIVSRHFGFNPEEHKVYVRGGEGLGQK
GWTDACEMYCTQDLHDLGSLVEGKMDIPRQSLDKPIPYKYVIHRGGSSKDTVEYEFIYEQ
AQKKGEHVNRCLRVVSTSLGNGDWHQYDDIICMRSTGFFQQAKNRILDSTRKELLKGKKQ
AAVVMLDRIFSVLQPWSDINLQSFMTQFLQFYSVVREPMIHDGRARKWTSLQYEEKEVWT
NLWEHVKKQMAPFLEGKSGESLPADCPVRSKLTLGLSILFMVEAAEFTVPKKDLDSLCYL
LIPSAGSPEALHSDLSPVLRIRQRWRIYLTNLCLRCIDERCDRWLGILPLLHTCMQKSPP
KKNSKSQPEDTWAGLEGISFSEFRDKAPTRSQPLQFMQSKMALLRVDEYLFRSWLSVVPL
ESLSSYLENSIDYLSDVPVRVLDCLQGISYRLPGLRKISNQNMKKDVENVFKMLMHLVDI
YQHRIFGENLLQIYLTECLTLHETVCNITANHQFFEIPALSAELICKLLELSPPGHTDEG
LPEKSYEDLVTSTLQEALATTRNWLRSLFKSRMLSISSAYVRLTYSEEMAVWRRLVEIGF
PEKHGWKGSLLGDMEGRLKQEPPRLQISFFCSSQCRDGGLHDSVSRSFEKCVIEAVSSAC
QSQTSVLEGLSCQDLQKFGTLLSAVITKSWPVHNGEPVFDVDEIFKYLLKWPDVRQLFEL
CGTNEKIIDNITEEGRQLMATAESVFQKVAGELENGTIVVGQLELILEHQSQFLDIWNLN
RRRLPSQEKACDVRSLLKRRRDDLLFLKQEKRYVESLLRQLGRVKHLVQVDFGNIEIIHS
QDLSNKKLNEAVIKLPNSSSYKRETHYCLSPDIREMASKLDSLKDSHIFQDFWQETAESL
NTLDKDPRELKVSLPEVLEYLYNPCYDNFYTLYENLKSGKITFAEVDAIFKDFVDKYDEL
KNDLKFMCTMNPQDQKGWISERVGQIKEYHTLHQAVSSAKVILQVRRALGVTGDFSVLNP
LLNFADSFEDFGNEKLDQISPQFIKAKQLLQDISEPRQRCLEELARQTELVAWLHKALED
INELKVFVDLASISAGENDIDVDRVACFHDAVQGYASLLYKMDERTNFSDFMNHLQELWR
ALDNDQHLPDKLKDSARNLEWLKTVKESHGSVELSSLSLATAINSRGVYVIEAPKDGQKI
SPDTVLRLLLPDGHGYPEALRTYSTEELKELLNKLMLMSGKKDHNSNTEVEKFSEVFSNM
QRLVHVFIKLHCAGNMLFRTWTAKVYCCPDGGIFMNFGLELLSQLTEKGDVIQLLGALCR
QMEDFLDNWKTVVAQKRAEHFYLNFYTAEQLVYLSSELRKPRPSEAALMMLSFIKGKCTV
QDLVQATSACESKADRYCLREVMKKLPQQLLSEPSLMGKLQVIMMQSLVYMSAFLPHCLD
LDALGRCLAHLATMGGTPVERPLPKGLQAGQPNLILCGHSEVLPAALAIYMQAPRQPLPT
FDEVLLCTPATTIEEVELLLRRCLTSGSQGHKVYSLLFADQLSYEVGCQAEEFFQSLCTR
AHREDYQLVILCDAAREHCYIPSTFSQYKVPLVPQAPLPNIQAYLQSHYQVPKRLLSAAT
VFRDGLCVGIVTSERAGVGKSLYVNTLHTKLKAKLRDETVPLKIIRLTEPHLDENQVLSA
LLPFLKEKYQKMPVIFHIDISTSVQTGIPIFLFKLLILQYLMDINGKIWRRSPGHLYLVE
IPQGLSVQPKRSSKLNARAPLFKFLDLFPKVTCRPPKEVIDMELTPERSHTDPAMDPVEF
CSEAFQRPYQYLKRFHQQQNLDTFQYEKGSVEGSPEECLQHFLIYCGLINPSWSELRNFA
WFLNCQLKDCEASIFCKSAFTGDTLRGFKNFVVTFMILMARDFATPTLHTSDQSPGRQSV
TIGEVVEEDLAPFSLRKRWESEPHPYVFFNGDHMTMTFIGFHLETNNNGYVDAINPSNGK
VIKKDVMTKELFDGLRLQRVPFNIDFDNLPRYEKLERLCLALGIEWPIDPDETYELTTDN
MLKILAIEMRFRCGIPVIIMGETGCGKTRLIKFLSDLKRGSVEAETMKLVKVHGGTTPSM
IYSKVKEAERTAFSNKAQHKLDTILFFDEANTTEAVSCIKEILCDRTVDGEHLHEDSGLH
IIAACNPYRKHSQEMILRLESAGLGYRVSAEETADRLGSIPLRQLVYRVHALPPSLIPLV
WDFGQLNDSAEKLYIQQIVQRLVDSVSVNPSETCVIADVLSASQMFMRKRENECGFVSLR
DVERCVKVFRWFHDHSDMLLKELDKFLHESSDSTHTFERDPVLWSLVMAIGVCYHASLEE
KASYRTAIARCFPKPYNSSRAILDEVTHVQDLFLRGAPIRTNIARNLALKENVFMMVICI
ELKIPLFLVGKPGSSKSLAKIIVADAMQGQAAFSELFRCLKQVHLVSFQCSPHSTPQGII
STFKQCARFQQGKDLGQYVSVVVLDEVGLAEDSPKMPLKTLHPLLEDGCIEDDPAPYKKV
GFVGISNWALDPAKMNRGIFVSRGSPNEKELIESAEGICSSDRLVQDKIRGYFAPFAKAY
ETVCQKQDKEFFGLRDYYSLIKMVFAKAKASKRGLSPQDITHAVLRNFSGKDNIQALSIF
TASLPEARYKEEVSTVELIKQNIYPGPQASSRGLDGAESRYLLVLTRNYVALQILQQTFF
EGQQPEIIFGSSFPQDQEYTQICRNINRVKICMETGKMVVLLNLQNLYESLYDALNQYYV
YLGGQKYVDLGLGTHRVKCRVHTAFRLIVIEEKDVVYKQFPVPLINRLEKHYLDMNTVLQ
PWQKSIVQELQQWAHEFADVKADQFIARHKYSPADVFIGYHSDACASVVLQAVERQGCRD
LTEELYRKVSEEARSILLDCATPDAVVRLSGSSLGSFTAKQLSQEYYYAQQHNSFVDFLQ
AHLRMTHHECRAVFTEITTFSRLLTGNDCDVLASELRGLASKPVVLSLQQYDTEYSFLKD
VRSWLTNPGKRKVLVIQADFDDGTRSAQLVASAKYTAINEINKTQGTKDFVFVYFVTKLS
RMGSGTSYVGFHGGLWRSVHIDDLRRSTIMASDVTKLQNVTISQLFKPEDKPEQEEMEIE
TSQSKELAEEQMEVEDSEEMKKASDPRSCDCSQFLDTTRLVQSCVQGAVGMLRDQNESCA
RNMRRVTILLDLLNEDNTRNASFLRESKMRLHVLLNKQEENQVRSLKEWVTREAANQDAL
QEAGTFRHTLWKRVQDVVTPILASMIAHIDRDGNLELLAQPDSPAWVQDLWMFIYSDIKF
LNISLVLNNTRSNSEMSFILVQSHMNLLKDAYNAVPFSWRIRDYLEELWVQAQYITDTEG
LSKKFVEIFQKTPLGVFLAQFPVAQQQKLLQSYLKDFLLLTMKVSSREELMFLQMALWSC
LRELQEASGTPDETYKFPLSLPWVHLAFQHFRTRLQNFSRILTIHPQVLSSLSQAAEKHS
LAGCEMTLDAFAAMACAEMLKGDLLKPSPKAWLQLVKNLSTPLELVCSEGYLCDSGSMTR
SVIQEVRALWNRIFSIALFVEHVLLGTESHIPELSPLVTTYVSLLDKCLEEDSNLKTCRP
FVAVMTTLCDCKDKASKKFSRFGIQPCFICHGDAQDPVCLPCDHVYCLRCIQTWLIPGQM
MCPYCLTDLPDKFSPTVSQDHRKAIEKHAQFRHMCNSFFVDLVSTMCFKDNTPPEKSVID
TLLSLLFVQKELLRDASQKHREHTKSLSPFDDVVDQTPVIRSVLLKLLLKYSFHEVKDYI
QNYLTQLEKKAFLTEDKTELYLLFISCLEDSVHQKTSAGCRNLEQVLREEGHFLRTYSPG
LQGQEPVRIASVEYLQEVARVRLCLDLAADFLSELQEGSELAEDKRRFLKHVEEFCTRVN
NDWHRVYLVRKLSSQRGMEFVQSFSKQGHPCQWVFPRKVIAQQKDHVSLMDRYLVHGNEY
KAVRDATAKAVLECKTLDIGNALMACRSPKPQQTAYLLLALYTEVAALYRSPNGSLHPEA
KQLEAVNKFIKESKILSDPNIRCFARSLVDNTLPLLKIRSANSILKGTVTEMAVHVATIL
LCGHNQILKPLRNLAFYPVNMANAFLPTMPEDLLVHARTWRGLENVTWYTCPRGHPCSVG
ECGRPMQESTCLDCGLPVGGLNHTPHEGFSAIRNNEDRTQTGHVLGSPQSSGVAEVSDRG
QSPVVFILTRLLTHLAMLVGATHNPQALTVIIKPWVQDPQGFLQQHIQRDLEQLTKMLGR
SADETIHVVHLILSSLLRVQSHGVLNFNAELSTKGCRNNWEKHFETLLLRELKHLDKNLP
AINALISQDERISSNPVTKIIYGDPATFLPHLPQKSIIHCSKIWSCRRKITVEYLQHIVE
QKNGKETVPVLWHFLQKEAELRLVKFLPEILALQRDLVKQFQNVSRVEYSSIRGFIHSHS
SDGLRKLLHDRITIFLSTWNALRRSLETNGEIKLPKDYCCSDLDLDAEFEVILPRRQGLG
LCGTALVSYLISLHNNMVYTVQKFSNEDNSYSVDISEVADLHVISYEVERDLNPLILSNC
QYQVQQGGETSQEFDLEKIQRQISSRFLQGKPRLTLKGIPTLVYRRDWNYEHLFMDIKNK
MAQSSLPNLAISTISGQLQS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1

Primary citation

Quality control of glycogen through direct ubiquitylation by RNF213. Yip, M.C.J., Naydenova, K., Otten, E.G. et al. Nature (2026). DOI 10.1038/s41586-026-11139-6 · PubMed

Other PDB entries of the same protein (UniProt E9Q555), best resolution first:

33HM 3.1 Å, Murine RNF213 (Y434A)
9T8I 3.1 Å, Murine RNF213
6TAX 3.2 Å, Mouse RNF213 wild type protein
6TAY 3.2 Å, Mouse RNF213 mutant R4753K modeling the Moyamoya-disease-related Human variant R4810K
7OIK 3.5 Å, Mouse RNF213:UBE2L3 transthiolation intermediate, chemically stabilized
9I1J 3.8 Å, Cryo-EM structure of mouse RNF213:UBE2L3 transthiolation intermediate, chemically…
7OIM 4.0 Å, Mouse RNF213, with mixed nucleotides bound
9I1I 4.5 Å, Cryo-EM structure of mouse RNF213 (WB3/WB4 + ATP)

Browse structure collections

About this viewer

MolViewer shows 9T8H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.