9TMK: CYLD CAP-Gly2

Structure of CYLD CAP-Gly2 bound to Listeria effector protein InlC. Determined by X-ray diffraction at 1.8 Å resolution. Released 30 Sept 2026.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Listeria monocytogenes, Homo sapiens
Chains: 2
Atoms: 3,017
Mol. weight: 39.57 kDa
Ligands: MG
Released: 30 Sept 2026

Explore 9TMK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9TMK contains 14 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	41-42	2	1
α-helix	43-46	4
α-helix	50-60	11
β-strand	68-69	2	1
α-helix	71-75	5
β-strand	79-81	3	2
α-helix	93-95	3
β-strand	101-103	3	2
α-helix	113-115	3
β-strand	123-125	3	2
β-strand	144-146	3	2
α-helix	156-158	3
β-strand	166-168	3	2
α-helix	180-182	3
β-strand	188-190	3	2
β-strand	198	1	3
α-helix	202-204	3
β-strand	210-212	3	2
β-strand	213-219	7	4
α-helix	220-222	3
β-strand	223-224	2	5
β-strand	228-232	5	6
β-strand	236	1	3
α-helix	241	1
β-strand	242	1	3
α-helix	243-245	3
β-strand	247-248	2	4
β-strand	253-255	3	6
β-strand	258-262	5	6
β-strand	269-280	12	4
β-strand	283-294	12	4
β-strand	295-296	2	5

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	235-240	6	7
β-strand	243-254	12	7
α-helix	255	1
α-helix	259-261	3
β-strand	263-269	7	7
β-strand	279-280	2	8
β-strand	283-284	2	8
β-strand	294-298	5	7
α-helix	299-301	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Internalin C	A	protein	265	Listeria monocytogenes	P71451 (AlphaFold model)
Ubiquitin carboxyl-terminal hydrolase CYLD	B	protein	90	Homo sapiens	Q9NQC7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9TMK_1 Internalin C (chains A)
GPESIQRPTPINQVFPDPGLANAVKQNLGKQSVTDLVSQKELSGVQNFNGDNSNIQSLAG
MQFFTNLKELHLSHNQISDLSPLKDLTKLEELSVNRNRLKNLNGIPSACLSRLFLDNNEL
RDTDSLIHLKNLEILSIRNNKLKSIVMLGFLSKLEVLDLHGNEITNTGGLTRLKKVNWID
LTGQKCVNEPVKYQPELYITNTVKDPDGRWISPYYISNGGSYVDGCVLWELPVYTDEVSY
KFSEYINVGETEAIFDGTVTQPIKN

Sequence of entity 2 (B), FASTA

>9TMK_2 Ubiquitin carboxyl-terminal hydrolase CYLD (chains B)
GPELPPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGV
QLCSFACVESTILLHINDIIPALSESVTQE

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (TRS) are not listed.

Primary citation

To Be Published. Ammendolia, D.A., Ellison, C.J., Zheng, Y. et al. To be published. DOI 10.1038/s41467-026-77063-5

Other PDB entries of the same protein (UniProt P71451 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1XEU 2.05 Å, Crystal Structure of Internalin C from Listeria monocytogenes
4CC4 2.6 Å, Complex of InlC of Listeria monocytogenes and human Tuba C-terminal SH3 domain

Browse structure collections

About this viewer

MolViewer shows 9TMK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.