9UIU: Alpha-parvin CH1 dimer

Crystal structure of alpha-parvin CH1 dimer. Determined by X-ray diffraction at 2.35 Å resolution. Released 22 Apr 2026.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,418
Mol. weight: 36.44 kDa
Released: 22 Apr 2026

Explore 9UIU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UIU contains 18 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	92-108	17
α-helix	119-122	4
α-helix	127-141	15
α-helix	148-149	2
α-helix	150-168	19
α-helix	172-174	3
α-helix	179-183	5
α-helix	187-200	14
α-helix	207-208	2
β-strand	212-221	10	1
β-strand	224-233	10	1

Chain B: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	92-108	17
α-helix	110-112	3
α-helix	119-122	4
α-helix	127-141	15
α-helix	150-168	19
α-helix	172-174	3
α-helix	179-183	5
α-helix	187-200	14
α-helix	207-208	2
β-strand	212-221	10	1
β-strand	224-233	10	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-parvin	A, B	protein	160	Homo sapiens	Q9NVD7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9UIU_1 Alpha-parvin (chains A, B)
GPGSEFSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNV
AEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRA
PIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEALSG

Primary citation

Alpha-Parvin as a novel mechanosensor crucial for adhesion tensional homeostasis. Guo, K., Pei, L., Zhang, T. et al. To be published.

Other PDB entries of the same protein (UniProt Q9NVD7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VZC 1.05 Å, Crystal structure of the C-terminal calponin homology domain of alpha parvin
9TP9 1.45 Å, Crystal structure of integrin-linked kinase (ILK) in complex with Alpha-Parvin and…
9D5E 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to gefitinib
9D5F 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to bosutinib
9D5H 1.5 Å, Crystal structure of the ILK mutant (R371Q)/alpha-parvin core complex bound to gefitinib
9D5I 1.5 Å, Crystal structure of the ILK mutant (R225A)/alpha-parvin core complex bound to MgATP
9D5P 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to erlotinib
9TPD 1.5 Å, Crystal structure of integrin-linked kinase (ILK) in complex with alpha-parvin and a…
9D5G 1.55 Å, Crystal structure of the ILK/alpha-parvin core complex bound to 4-methyl erlotinib
2VZG 1.8 Å, Crystal structure of the C-terminal calponin homology domain of alpha- parvin in complex…
3KMU 1.8 Å, Crystal structure of the ILK/alpha-parvin core complex (apo)
3REP 1.8 Å, Crystal structure of the ILK/alpha-parvin core complex (MnATP)

Browse structure collections

About this viewer

MolViewer shows 9UIU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.