9UKR: Glycogen phosphorylase from E. coli

Crystal structure of glycogen phosphorylase from E. coli in complex with AMP. Determined by X-ray diffraction at 3.55 Å resolution. Released 18 Feb 2026.

Method: X-ray diffraction
Resolution: 3.55 Å
Organism: Escherichia coli K12
Chains: 6
Atoms: 39,190
Mol. weight: 564.96 kDa
Ligands: AMP
Released: 18 Feb 2026

Explore 9UKR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UKR contains 293 α-helices and 152 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 48 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	12-27	16
α-helix	38-66	29
β-strand	71-75	5	1
α-helix	85-91	7
α-helix	95-103	9
α-helix	109-113	5
α-helix	117-119	3
α-helix	125-139	15
β-strand	145-149	5	1
β-strand	157-161	5	2
β-strand	164-168	5	2
α-helix	172-175	4
β-strand	181-192	12	1
β-strand	195-199	5	3
β-strand	202-206	5	3
β-strand	209-221	13	1
α-helix	222	1
β-strand	228-238	11	1
α-helix	242-245	4
α-helix	252-255	4
α-helix	262-266	5
α-helix	279-305	27
α-helix	311-314	4
β-strand	315-319	5	1
α-helix	323-326	4
α-helix	327-339	13
α-helix	343-353	11
β-strand	354-357	4	1
β-strand	368-370	3	4
α-helix	371-377	7
α-helix	379-399	21
α-helix	404-410	7
β-strand	413-414	2	4
β-strand	420-422	3	4
α-helix	423-429	7
β-strand	433-436	4	1
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-463	3	1
β-strand	468	1	5
α-helix	470	1
α-helix	471-476	6
α-helix	479-489	11
α-helix	492-494	3
α-helix	499-503	5
α-helix	510-535	26
β-strand	544-549	6	6
α-helix	554-556	3
α-helix	558-572	15
α-helix	580-582	3
β-strand	583-588	6	6
α-helix	596-612	17
α-helix	619-621	3
β-strand	622-627	6	6
α-helix	632-638	7
α-helix	639-641	3
β-strand	644-647	4	6
α-helix	649-650	2
α-helix	658-664	7
α-helix	668	1
β-strand	669-672	4	6
α-helix	677-685	9
β-strand	691-692	2	6
α-helix	697-705	9
α-helix	711-714	4
α-helix	718-728	11
α-helix	741-748	8
α-helix	760-774	15
α-helix	777-789	13
β-strand	795	1	5
α-helix	796-806	11

Chain B: 48 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	12-24	13
α-helix	25-29	5
α-helix	38-65	28
β-strand	71-75	5	7
α-helix	85-92	8
α-helix	95-104	10
α-helix	109-113	5
α-helix	117-119	3
α-helix	125-139	15
β-strand	144-149	6	7
β-strand	156-161	6	8
β-strand	164-169	6	8
α-helix	172-175	4
β-strand	181-192	12	7
β-strand	195-198	4	9
β-strand	203-206	4	9
β-strand	209-221	13	7
α-helix	222	1
β-strand	228-238	11	7
α-helix	242-245	4
α-helix	253-256	4
α-helix	262-266	5
α-helix	279-305	27
α-helix	311-314	4
β-strand	315-319	5	7
α-helix	323-326	4
α-helix	327-337	11
α-helix	343-353	11
β-strand	354-357	4	7
β-strand	368-370	3	10
α-helix	371-377	7
α-helix	379-399	21
α-helix	405-409	5
β-strand	413-414	2	10
β-strand	420-422	3	10
α-helix	423-429	7
β-strand	433-436	4	7
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-463	3	7
β-strand	468	1	11
α-helix	470	1
α-helix	471-476	6
α-helix	479-489	11
α-helix	492-494	3
α-helix	499-502	4
α-helix	510-535	26
β-strand	544-549	6	12
α-helix	554-556	3
α-helix	558-572	15
β-strand	583-588	6	12
α-helix	596-612	17
α-helix	619-621	3
β-strand	622-627	6	12
α-helix	632-641	10
β-strand	644-647	4	12
α-helix	649-650	2
α-helix	658-665	8
α-helix	668	1
β-strand	669-672	4	12
α-helix	677-685	9
β-strand	691-692	2	12
α-helix	697-705	9
α-helix	711-714	4
α-helix	718-728	11
α-helix	741-748	8
α-helix	760-774	15
α-helix	777-789	13
β-strand	795	1	11
α-helix	796-803	8
α-helix	804-808	5

Chain C: 49 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	12-27	16
α-helix	33-35	3
α-helix	38-67	30
β-strand	71-75	5	13
α-helix	85-92	8
α-helix	95-104	10
α-helix	109-113	5
α-helix	117-119	3
α-helix	125-139	15
β-strand	144-149	6	13
β-strand	157-161	5	14
β-strand	164-168	5	14
α-helix	172-175	4
β-strand	181-192	12	13
β-strand	195-199	5	15
β-strand	202-206	5	15
β-strand	209-221	13	13
α-helix	222	1
β-strand	228-238	11	13
α-helix	242-245	4
α-helix	252-256	5
α-helix	262-266	5
α-helix	279-305	27
α-helix	311-314	4
β-strand	315-319	5	13
α-helix	323-326	4
α-helix	327-337	11
α-helix	343-353	11
β-strand	354-357	4	13
β-strand	368-370	3	16
α-helix	371-377	7
α-helix	379-399	21
α-helix	405-409	5
β-strand	413-414	2	16
β-strand	420-422	3	16
α-helix	423-429	7
β-strand	433-436	4	13
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-463	3	13
β-strand	468	1	17
α-helix	470	1
α-helix	471-476	6
α-helix	479-489	11
α-helix	492-494	3
α-helix	499-502	4
α-helix	511-535	25
β-strand	544-549	6	18
β-strand	552	1	19
α-helix	554-556	3
α-helix	558-572	15
α-helix	580-582	3
β-strand	583-588	6	18
β-strand	591	1	19
α-helix	596-612	17
α-helix	619-621	3
β-strand	622-627	6	18
α-helix	632-641	10
β-strand	644-647	4	18
α-helix	649-650	2
α-helix	658-664	7
α-helix	668	1
β-strand	669-672	4	18
α-helix	677-685	9
β-strand	691-692	2	18
α-helix	697-705	9
α-helix	711-714	4
α-helix	718-728	11
α-helix	741-748	8
α-helix	760-774	15
α-helix	777-789	13
β-strand	795	1	17
α-helix	796-803	8
α-helix	804-808	5

Chain D: 49 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	12-24	13
α-helix	25-29	5
α-helix	33-35	3
α-helix	38-65	28
β-strand	71-75	5	20
α-helix	85-92	8
α-helix	95-104	10
α-helix	109-113	5
α-helix	117-119	3
α-helix	125-139	15
β-strand	144-149	6	20
β-strand	157-161	5	21
β-strand	164-168	5	21
α-helix	172-175	4
β-strand	180-192	13	20
β-strand	195-198	4	22
β-strand	203-206	4	22
β-strand	209-221	13	20
α-helix	222	1
β-strand	228-238	11	20
α-helix	242-245	4
α-helix	253-256	4
α-helix	262-266	5
α-helix	279-305	27
α-helix	311-314	4
β-strand	315-319	5	20
α-helix	323-326	4
α-helix	327-337	11
α-helix	343-353	11
β-strand	354-357	4	20
β-strand	368-370	3	23
α-helix	371-377	7
α-helix	379-399	21
α-helix	404-409	6
β-strand	413-414	2	23
β-strand	420-422	3	23
α-helix	423-429	7
β-strand	433-436	4	20
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-463	3	20
β-strand	468	1	24
α-helix	470	1
α-helix	471-476	6
α-helix	479-489	11
α-helix	492-494	3
α-helix	499-502	4
α-helix	510-535	26
β-strand	544-549	6	25
β-strand	552	1	26
α-helix	554-556	3
α-helix	558-572	15
β-strand	583-588	6	25
β-strand	591	1	26
α-helix	596-612	17
α-helix	619-621	3
β-strand	622-627	6	25
α-helix	632-641	10
β-strand	644-647	4	25
α-helix	649-650	2
α-helix	658-665	8
α-helix	668	1
β-strand	669-672	4	25
α-helix	677-685	9
β-strand	691-692	2	25
α-helix	697-705	9
α-helix	711-714	4
α-helix	718-728	11
α-helix	741-748	8
α-helix	760-774	15
α-helix	777-789	13
β-strand	795	1	24
α-helix	796-803	8
α-helix	804-808	5

Chain E: 48 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	13-24	12
α-helix	25-29	5
α-helix	38-65	28
β-strand	71-75	5	27
α-helix	85-92	8
α-helix	95-104	10
α-helix	109-113	5
α-helix	117-118	2
α-helix	125-139	15
β-strand	144-149	6	27
β-strand	157-161	5	28
β-strand	164-168	5	28
α-helix	172-175	4
β-strand	181-192	12	27
β-strand	195-198	4	29
β-strand	203-206	4	29
β-strand	209-222	14	27
β-strand	225-237	13	27
α-helix	242-245	4
α-helix	253-256	4
α-helix	262-266	5
α-helix	279-305	27
α-helix	311-314	4
β-strand	315-319	5	27
α-helix	323-326	4
α-helix	327-337	11
α-helix	343-353	11
β-strand	354-357	4	27
β-strand	368-370	3	30
α-helix	371-377	7
α-helix	379-399	21
α-helix	405-409	5
β-strand	413-414	2	30
β-strand	420-422	3	30
α-helix	423-429	7
β-strand	433-436	4	27
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-463	3	27
β-strand	468	1	31
α-helix	470	1
α-helix	471-476	6
α-helix	479-489	11
α-helix	492-494	3
α-helix	499-503	5
α-helix	509-535	27
β-strand	544-549	6	32
β-strand	552	1	33
α-helix	554-556	3
α-helix	558-572	15
α-helix	580-582	3
β-strand	583-588	6	32
β-strand	591	1	33
α-helix	596-612	17
α-helix	619-621	3
β-strand	622-627	6	32
α-helix	632-641	10
β-strand	644-647	4	32
α-helix	649-650	2
α-helix	658-664	7
α-helix	668	1
β-strand	669-672	4	32
α-helix	678-685	8
β-strand	691-692	2	32
α-helix	697-705	9
α-helix	711-714	4
α-helix	718-728	11
α-helix	741-748	8
α-helix	760-774	15
α-helix	777-789	13
β-strand	795	1	31
α-helix	796-803	8
α-helix	804-808	5

Chain F: 51 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	13-24	12
α-helix	25-29	5
α-helix	33-35	3
α-helix	38-65	28
β-strand	71-75	5	34
α-helix	85-92	8
α-helix	95-104	10
α-helix	109-113	5
α-helix	117-119	3
α-helix	125-139	15
β-strand	144-149	6	34
β-strand	157-161	5	35
β-strand	164-168	5	35
α-helix	172-175	4
β-strand	180-192	13	34
β-strand	195-198	4	36
β-strand	203-206	4	36
β-strand	209-221	13	34
α-helix	222	1
β-strand	228-238	11	34
α-helix	242-245	4
α-helix	252-256	5
α-helix	262-266	5
α-helix	280-305	26
α-helix	311-314	4
β-strand	315-319	5	34
α-helix	323-326	4
α-helix	327-339	13
α-helix	343-353	11
β-strand	354-357	4	34
β-strand	368-370	3	37
α-helix	371-377	7
α-helix	379-399	21
α-helix	404-409	6
β-strand	413-414	2	37
β-strand	420-422	3	37
α-helix	423-429	7
β-strand	433-436	4	34
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-463	3	34
β-strand	468	1	38
α-helix	470	1
α-helix	471-476	6
α-helix	479-489	11
α-helix	492-494	3
α-helix	499-501	3
α-helix	502-505	4
α-helix	510-535	26
β-strand	544-549	6	39
β-strand	552	1	40
α-helix	554-556	3
α-helix	558-572	15
α-helix	580-582	3
β-strand	583-588	6	39
β-strand	591	1	40
α-helix	596-612	17
α-helix	619-621	3
β-strand	622-627	6	39
α-helix	632-641	10
β-strand	644-647	4	39
α-helix	649-650	2
α-helix	658-665	8
α-helix	668	1
β-strand	669-672	4	39
α-helix	677-685	9
β-strand	691-692	2	39
α-helix	697-705	9
α-helix	710-714	5
α-helix	718-728	11
α-helix	741-748	8
α-helix	760-774	15
α-helix	777-789	13
β-strand	795	1	38
α-helix	796-803	8
α-helix	804-808	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycogen phosphorylase	A, B, C, D, E, F	protein	817	Escherichia coli K12	P0AC86 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>9UKR_1 Glycogen phosphorylase (chains A, B, C, D, E, F)
MGMNAPFTYSSPTLSVEALKHSIAYKLMFTIGKDPVVANKHEWLNATLFAVRDRLVERWL
RSNRAQLSQETRQVYYLSMEFLIGRTLSNAMLSLGIYEDVQGALEAMGLNLEELIDEEND
PGLGNGGLGRLAACFLDSLATLGLPGRGYGIRYDYGMFKQNIVNGSQKESPDYWLEYGNP
WEFKRHNTRYKVRFGGRIQQEGKKTRWIETEEILGVAYDQIIPGYDTDATNTLRLWSAQA
SSEINLGKFNQGDYFAAVEDKNHSENVSRVLYPDDSTYSGRELRLRQEYFLVSSTIQDIL
SRHYQLHKTYDNLADKIAIHLNDTHPVLSIPEMMRLLIDEHQFSWDDAFEVCCQVFSYTN
HTLMSEALETWPVDMLGKILPRHLQIIFEINDYFLKTLQEQYPNDTDLLGRASIIDESNG
RRVRMAWLAVVVSHKVNGVSELHSNLMVQSLFADFAKIFPGRFTNVTNGVTPRRWLAVAN
PSLSAVLDEHLGRNWRTDLSLLNELQQHCDFPMVNHAVHQAKLENKKRLAEYIAQQLNVV
VNPKALFDVQIKRIHEYKRQLMNVLHVITRYNRIKADPDAKWVPRVNIFGGKAASAYYMA
KHIIHLINDVAKVINNDPQIGDKLKVVFIPNYSVSLAQLIIPAADLSEQISLAGTEASGT
SNMKFALNGALTIGTLDGANVEMLDHVGADNIFIFGNTAEEVEELRRQGYKPREYYEKDE
ELHQVLTQIGSGVFSPEDPGRYRDLVDSLINFGDHYQVLADYRSYVDCQDKVDELYELQE
EWTAKAMLNIANMGYFSSDRTIKEYADHIWHIDPVRL

Ligands and cofactors

ID	Name	Formula	Copies
AMP	Adenosine monophosphate	C10 H14 N5 O7 P	8

Primary citation

Structural and mechanistic diversity of glycogen phosphorylases from gut bacteria. Shobu, K., Takai, M., Tanino, H. et al. Proc Natl Acad Sci U S A (2026) 123:e2518513123-e2518513123. DOI 10.1073/pnas.2518513123 · PubMed

Other PDB entries of the same protein (UniProt P0AC86 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9S8K 2.06 Å, Structure of glycogen phosphorylase - tetrameric form - in complex with HPr from…
9S8B 2.79 Å, Structure of glycogen phosphorylase - dimeric form - in complex with HPr from…
9M9P 2.93 Å, Glycogen phosphorylase dimer from E. coli
9S86 2.97 Å, Structure of glycogen phosphorylase - tetrameric form - from Escherichia coli
9S7V 3.1 Å, Structure of glycogen phosphorylase - dimeric form - from Escherichia coli
9V16 3.45 Å, Crystal structure of E. coli glycogen phosphorylase N185A/R267E mutant in complex with AMP
9UKQ 3.5 Å, Crystal structure of glycogen phosphorylase from Escherichia coli
9V17 3.7 Å, Crystal structure of E. coli glycogen phosphorylase N185A/R267E mutant

Browse structure collections

About this viewer

MolViewer shows 9UKR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.