9UL1: Tibetan wild boar SLA-1*Z0301 for 2.32 angstrom

Crystal structure of Tibetan wild boar SLA-1*Z0301 for 2.32 angstrom. Determined by X-ray diffraction at 2.32 Å resolution. Released 13 Aug 2025.

Method: X-ray diffraction
Resolution: 2.32 Å
Organisms: Sus scrofa, Porcine reproductive and respiratory syndrome virus
Chains: 3
Atoms: 3,118
Mol. weight: 44.22 kDa
Released: 13 Aug 2025

Explore 9UL1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UL1 contains 10 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	4-15	12	1
β-strand	20-29	10	1
β-strand	32-38	7	1
β-strand	47-48	2	1
α-helix	51-55	5
α-helix	58-86	29
β-strand	95-104	10	1
β-strand	110-119	10	1
β-strand	122-127	6	1
β-strand	134-136	3	1
α-helix	139-151	13
α-helix	153-159	7
α-helix	160-165	6
α-helix	166-175	10
α-helix	177-180	4
β-strand	184	1	2
α-helix	185-186	2
β-strand	187-196	10	3
β-strand	199-209	11	3
β-strand	210	1	2
β-strand	215-220	6	4
β-strand	223-224	2	4
β-strand	230-231	2	3
β-strand	235-236	2	3
β-strand	242-250	9	3
α-helix	255-257	3
β-strand	259-263	5	4
β-strand	271-273	3	4

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	5
α-helix	6-7	2
β-strand	8-13	6	6
β-strand	23-32	10	6
β-strand	33	1	5
β-strand	38-43	6	7
β-strand	46-47	2	7
β-strand	51-52	2	6
β-strand	56-57	2	6
β-strand	63-71	9	6
β-strand	79-84	6	7
β-strand	92-95	4	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MHC class I antigen	A	protein	276	Sus scrofa	A0A286S063 (AlphaFold model)
Beta-2-microglobulin	B	protein	97	Sus scrofa	Q07717 (AlphaFold model)
Ala-leu-leu-ser-ser-lys-thr-ser-val	C	protein	9	Porcine reproductive and respiratory syndrome virus

Sequence of entity 1 (A), FASTA

>9UL1_1 MHC class I antigen (chains A)
MGPHSLRYFYTAVSRPDRGDSRFFIVGYVDDTQFVRFDSDAPNAKMEPRAQWIKQEGPEY
WDRETQISKEAAQNYRGSLNNLRGYYNQSEAGSHTFQNMYGCYLGPDGLLLRGYHQFAYD
GADYIALNEDLRSWTAADMAAQITKRKWKAAHEAERDRNYLQGTCVEWLQKYLEMGKDTL
QRAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDG
TFQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWD

Sequence of entity 2 (B), FASTA

>9UL1_2 Beta-2-microglobulin (chains B)
ARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKDWSF
YLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH

Sequence of entity 3 (C), FASTA

>9UL1_3 ALA-LEU-LEU-SER-SER-LYS-THR-SER-VAL (chains C)
ALLSSKTSV

Primary citation

Structural basis of Tibetan wild boar SLA-1*Z0301 reveals conserved peptide presentation and potential high-altitude adaptation. Fan, S., Kang, C., Peng, J. et al. Int J Biol Macromol (2025) 320:145933-145933. DOI 10.1016/j.ijbiomac.2025.145933 · PubMed

Browse structure collections

About this viewer

MolViewer shows 9UL1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.