9UMU: Tubulin alpha-1B chain

Giraffe KIF5A motor domain in nucleotide free state bound to microtubule. Determined by electron microscopy at 4.4 Å resolution. Released 29 Apr 2026.

Method: Electron microscopy
Resolution: 4.4 Å
Organisms: Sus scrofa, Giraffa camelopardalis
Chains: 3
Atoms: 9,240
Mol. weight: 137.6 kDa
Ligands: GTP, GDP
Released: 29 Apr 2026

Explore 9UMU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UMU contains 63 α-helices and 50 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
α-helix	11-28	18
β-strand	54-55	2	2
β-strand	61-62	2	2
β-strand	65-68	4	1
α-helix	75-80	6
α-helix	84-86	3
α-helix	89-91	3
β-strand	92-93	2	1
α-helix	103-104	2
α-helix	105-109	5
α-helix	111-128	18
β-strand	132-139	8	1
α-helix	144-160	17
β-strand	165-171	7	1
α-helix	172-174	3
α-helix	183-194	12
β-strand	200-204	5	1
α-helix	207-212	6
α-helix	213-217	5
α-helix	224-243	20
β-strand	246	1	3
α-helix	252-259	8
β-strand	269-273	5	3
α-helix	278-283	6
α-helix	288-295	8
α-helix	298-300	3
β-strand	312-320	9	3
α-helix	325-338	14
β-strand	343	1	3
α-helix	348	1
β-strand	354-356	3	3
α-helix	359-360	2
β-strand	374-381	8	3
α-helix	384-400	17
α-helix	405-409	5
α-helix	415-434	20

Chain B: 26 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	4
α-helix	11-27	17
β-strand	30	1	5
β-strand	36	1	5
α-helix	42-44	3
α-helix	47-49	3
β-strand	51-53	3	6
β-strand	59-61	3	6
β-strand	63-66	4	4
α-helix	72-77	6
α-helix	82-84	3
α-helix	87-89	3
β-strand	90	1	4
α-helix	101-102	2
α-helix	103-107	5
α-helix	109-126	18
β-strand	130-137	8	4
α-helix	147-158	12
β-strand	164-168	5	4
α-helix	181-195	15
β-strand	198	1	4
β-strand	199-200	2	7
α-helix	204-209	6
α-helix	210-214	5
α-helix	222-241	20
β-strand	244	1	8
α-helix	250-257	8
β-strand	265-266	2	7
β-strand	268-271	4	9
α-helix	286-293	8
α-helix	296-298	3
β-strand	299	1	9
β-strand	310-318	9	9
α-helix	324	1
α-helix	325-329	5
α-helix	330-336	7
α-helix	337-339	3
β-strand	341	1	9
β-strand	349-353	5	9
β-strand	354	1	8
α-helix	356-358	3
β-strand	364-371	8	9
α-helix	375-390	16
α-helix	395-398	4
α-helix	399-401	3
α-helix	405-426	22

Chain J: 14 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	10
α-helix	21-26	6
β-strand	33-35	3	11
β-strand	39-42	4	11
β-strand	45-48	4	11
β-strand	51-53	3	10
α-helix	59-63	5
α-helix	67-75	9
β-strand	79	1	10
β-strand	83-84	2	10
α-helix	92-96	5
α-helix	108-120	13
β-strand	127-129	3	10
β-strand	132-138	7	10
β-strand	143-145	3	10
β-strand	156	1	12
α-helix	165	1
β-strand	166	1	12
β-strand	172-173	2	10
α-helix	177-190	14
β-strand	206-217	12	10
β-strand	222-232	11	10
α-helix	233-236	4
α-helix	249-270	22
α-helix	276-278	3
α-helix	283-288	6
α-helix	289-291	3
β-strand	299-303	5	10
α-helix	308-310	3
α-helix	311-322	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulin alpha-1B chain	A	protein	444	Sus scrofa	Q2XVP4 (AlphaFold model)
Tubulin beta chain	B	protein	444	Sus scrofa	Q767L7 (AlphaFold model)
GcKIF5A	J	protein	334	Giraffa camelopardalis

Sequence of entity 1 (A), FASTA

>9UMU_1 Tubulin alpha-1B chain (chains A)
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDDSFNTFFSETGAGKHVPRAVF
VDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLAD
QCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNS
ILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGA
LNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDP
RHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGD
LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAA
LEKDYEEVGVDSVEGEGEEEGEEY

Sequence of entity 2 (B), FASTA

>9UMU_2 Tubulin beta chain (chains B)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEEDFGEEAEEEA

Sequence of entity 3 (J), FASTA

>9UMU_3 GcKIF5A (chains J)
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIVQDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLAVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSFNDAETKSTLMFGQRAKTIKNTASVN

Ligands and cofactors

ID	Name	Formula	Copies
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	1
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Primary citation

Enhanced Axonal Transport in Large Vertebrates: KIF5A Adaptations in Giraffes and Pythons. Kambara, T., Rao, L., Yamagishi, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q2XVP4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9U6A 1.92 Å, Tubulin-DARPin D1 in complex with a flavone
5EZY 2.05 Å, Crystal structure of T2R-TTL-taccalonolide AJ complex
5YL2 2.09 Å, Crystal structure of T2R-TTL-Y28 complex
7TTF 2.1 Å, Tubulin-RB3_SLD in complex with compound 12k
5XKG 2.2 Å, Crystal structure of T2R-TTL-CH1 complex
7L05 2.21 Å, Complex of novel maytansinoid M24 bound to T2R-TTL (two tubulin alpha/beta heterodimers,…
9M1M 2.21 Å, Cryo-EM structure of the TBC-DEC-Arl2-alpha-beta-tubulin complex with GDP-AlFx
5JQG 2.24 Å, An apo tubulin-RB-TTL complex structure used for side-by-side comparison
9M1N 2.24 Å, Cryo-EM structure of the TBC-DC-Arl2-alpha-beta-tubulin complex with GDP-AlFx
5XKH 2.25 Å, Crystal structure of T2R-TTL-CF1 complex
7TTD 2.27 Å, Tubulin-RB3_SLD in complex with compound 12e
5JCB 2.3 Å, Microtubule depolymerizing agent podophyllotoxin derivative YJTSF1

Browse structure collections

About this viewer

MolViewer shows 9UMU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.