9UTH: DPF3b

DPF3b in complex with H3K14cr peptide. Determined by X-ray diffraction at 2.69 Å resolution. Released 6 May 2026.

Method: X-ray diffraction
Resolution: 2.69 Å
Organism: Homo sapiens
Chains: 8
Atoms: 4,431
Mol. weight: 63.38 kDa
Ligands: ZN
Released: 6 May 2026

Explore 9UTH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UTH contains 33 α-helices and 27 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	262	1	1
β-strand	282-283	2	1
β-strand	290-291	2	1
α-helix	300-306	7
β-strand	319	1	2
α-helix	328-330	3
β-strand	331-333	3	2
β-strand	340-342	3	2
α-helix	353-354	2
α-helix	361-366	6

Chains B and H: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-3	2	2
α-helix	4-10	7
α-helix	14-16	3
α-helix	17-24	8

Chain C: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	262	1	3
α-helix	280-281	2
β-strand	282-283	2	3
β-strand	290-291	2	3
α-helix	300-306	7
α-helix	328-330	3
β-strand	331-333	3	4
α-helix	334	1
β-strand	340-342	3	4
α-helix	361-366	6

Chain D: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2	1	4
α-helix	4-10	7
α-helix	14-16	3
α-helix	17-24	8

Chain E: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	257-259	3
β-strand	262	1	5
α-helix	280-281	2
β-strand	282-283	2	5
β-strand	290-291	2	5
α-helix	300-306	7
β-strand	319	1	6
α-helix	328-330	3
β-strand	331-333	3	6
α-helix	334	1
β-strand	340-342	3	6
α-helix	361-367	7

Chain F: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3	1	6
α-helix	4-10	7
α-helix	14-16	3
α-helix	17-24	8

Chain G: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	256-259	4
β-strand	262	1	7
α-helix	280-281	2
β-strand	282-283	2	7
β-strand	290-291	2	7
α-helix	300-306	7
β-strand	319	1	8
α-helix	328-330	3
β-strand	331-333	3	8
β-strand	340-342	3	8
α-helix	349-350	2
α-helix	361-366	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Zinc finger protein DPF3	A, C, E, G	protein	114	Homo sapiens	Q92784 (AlphaFold model)
Histone H3.3	B, D, F, H	protein	26	Homo sapiens	P84243 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>9UTH_1 Zinc finger protein DPF3 (chains A, C, E, G)
SVIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCI
ECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLK

Sequence of entity 2 (B, D, F, H), FASTA

>9UTH_2 Histone H3.3 (chains B, D, F, H)
ARTKQTARKSTGGXAPRKQLATKAAA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	16

Primary citation

DPF3b in complex with H3K14cr peptide. Feng, F., Huang, J., Xiang, B. et al. To be published.

Other PDB entries of the same protein (UniProt Q92784 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5SZC 1.19 Å, Structure of human Dpf3 double-PHD domain bound to histone H3 tail peptide with…
5SZB 1.2 Å, Structure of human Dpf3 double-PHD domain bound to histone H3 tail peptide with…
5I3L 1.85 Å, DPF3b in complex with H3K14ac peptide
2KWJ Solution structures of the double PHD fingers of human transcriptional protein DPF3…
2KWK Solution structures of the double PHD fingers of human transcriptional protein DPF3b…
2KWN Solution structure of the double PHD (plant homeodomain) fingers of human…
2KWO Solution structure of the double PHD (plant homeodomain) fingers of human…

Browse structure collections

About this viewer

MolViewer shows 9UTH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.