9UWG: Human DCAF2-DDB1 complex

Structure of the human DCAF2-DDB1 complex. Determined by electron microscopy at 3.21 Å resolution. Released 22 Apr 2026.

Method: Electron microscopy
Resolution: 3.21 Å
Organism: Homo sapiens
Chains: 2
Atoms: 8,822
Mol. weight: 208.83 kDa
Released: 22 Apr 2026

Explore 9UWG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UWG contains 17 α-helices and 96 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 68 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	1
β-strand	17-21	5	2
β-strand	30-35	6	2
β-strand	38-45	8	2
β-strand	48-56	9	2
β-strand	61-67	7	3
β-strand	76-81	6	3
β-strand	85-91	7	3
β-strand	100-107	8	3
α-helix	114	1
β-strand	115	1	4
α-helix	116	1
β-strand	121-124	4	5
β-strand	130-134	5	5
β-strand	136	1	4
β-strand	139-144	6	5
β-strand	156-158	3	5
β-strand	164-169	6	6
α-helix	170	1
β-strand	177-184	8	6
β-strand	187-196	10	6
β-strand	201-204	4	6
β-strand	210-212	3	6
β-strand	218-221	4	7
β-strand	229-232	4	7
β-strand	237-240	4	7
β-strand	245-248	4	7
α-helix	251-254	4
β-strand	258-263	6	8
β-strand	270-275	6	8
β-strand	279-287	9	8
β-strand	297-307	11	8
β-strand	311-318	8	9
β-strand	321-326	6	9
β-strand	331-336	6	9
β-strand	347-353	7	9
β-strand	361-365	5	10
β-strand	374-379	6	10
α-helix	382-384	3
β-strand	386-391	6	10
β-strand	711-716	6	10
β-strand	720-727	8	11
β-strand	732-742	11	11
β-strand	750-751	2	11
β-strand	762-764	3	11
β-strand	786-795	10	11
β-strand	801-806	6	11
β-strand	813-820	8	12
β-strand	827-833	7	12
β-strand	846-854	9	12
β-strand	857-866	10	12
β-strand	870-876	7	13
β-strand	879-884	6	13
β-strand	887-893	7	13
β-strand	899-905	7	13
β-strand	913-917	5	14
β-strand	920-924	5	14
β-strand	928	1	15
β-strand	931-936	6	14
β-strand	941-947	7	14
β-strand	952	1	15
β-strand	954-959	6	16
β-strand	964-969	6	16
β-strand	973-978	6	16
α-helix	986-989	4
β-strand	991	1	14
β-strand	993-999	7	16
β-strand	1004-1009	6	1
β-strand	1028-1032	5	1
β-strand	1037-1042	6	1
α-helix	1045-1061	17
α-helix	1063-1064	2
α-helix	1070-1074	5
β-strand	1076-1077	2	17
β-strand	1082-1083	2	17
β-strand	1086	1	16
β-strand	1088-1090	3	1
α-helix	1091-1095	5
α-helix	1096-1098	3
α-helix	1102-1108	7
α-helix	1126-1137	12

Chain B: 4 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	10-13	4
α-helix	29-31	3
β-strand	32-40	9	18
β-strand	56-57	2	19
β-strand	66-69	4	19
β-strand	75-76	2	20
β-strand	77-80	4	19
β-strand	94-95	2	20
β-strand	101-106	6	21
β-strand	113-117	5	21
β-strand	122	1	21
β-strand	143-147	5	22
β-strand	156-160	5	22
β-strand	165-168	4	22
β-strand	183-185	3	22
β-strand	219-224	6	23
β-strand	229-234	6	23
β-strand	240-244	5	23
β-strand	260-262	3	23
β-strand	274-279	6	24
β-strand	285-290	6	24
β-strand	294-299	6	24
β-strand	309-312	4	24
β-strand	323-325	3	25
β-strand	331-334	4	25
β-strand	341-345	5	25
α-helix	352-353	2
β-strand	354-356	3	25
β-strand	363-368	6	18
β-strand	375-380	6	18
β-strand	384-390	7	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA damage-binding protein 1	A	protein	1159	Homo sapiens	Q16531 (AlphaFold model)
Denticleless protein homolog	B	protein	730	Homo sapiens	Q9NZJ0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9UWG_1 DNA damage-binding protein 1 (chains A)
MHHHHHHSSGRENLYFQGHMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEI
YVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDII
TRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEE
LHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIA
VPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLF
MLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSN
AQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHAS
IDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCG
NVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQI
HPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEM
LGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTF
RSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTI
GTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQAL
SSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKL
GKDPNTYFIVGTAMVYPAEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLL
ASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGN
FEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLG
EFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKV
IKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMK
REATADDLIKVVEELTRIH

Sequence of entity 2 (B), FASTA

>9UWG_2 Denticleless protein homolog (chains B)
MLFNSVLRQPQLGVLRNGWSSQYPLQSLLTGYQCSGNDEHTSYGETGVPVPPFGCTFSSA
PNMEHVLAVANEEGFVRLYNTESQSFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQ
TAKFWDVKAGELIGTCKGHQCSLKSVAFSKFEKAVFCTGGRDGNIMVWDTRCNKKDGFYR
QVNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLVSAGAVDGII
KVWDLRKNYTAYRQEPIASKSFLYPGSSTRALGYSSLILDSTGSTLFANCTDDNIYMFNM
TGLKTSPVAIFNGHQNSTFYVKSSLSPDDQFLVSGSSDEAAYIWKVSTPWQPPTVLLGHS
QEVTSVCWCPSDFTKIATCSDDNTLKIWRLNRGLEEKPGGDKLSTVGWASQKKKESRPGL
VTVTSSQSTPAKAPRAKCNPSNSSPSSAACAPSCAGDLPLPSNTPTFSIKTSPAKARSPI
NRRGSVSSVSPKPPSSFKMSIRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQ
AEACSESRNRVKRRLDSSCLESVKQKCVKSCNCVTELDGQVENLHLDLCCLAGNQEDLSK
DSLGPTKSSKIEGAGTSISEPPSPISPYASESCGTLPLPLRPCGEGSEMVGKENSSPENK
NWLLAMAAKRKAENPSPRSPSSQTPNSRRQSGKKLPSPVTITPSSMRKICTYFHRKSQED
FCGPEHSTEL

Primary citation

Structure of the human DCAF2-DDB1 complex. Shen, M., Zhang, H. To be published.

Other PDB entries of the same protein (UniProt Q16531 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9BBG 1.7 Å, Co-crystal structure of human DDB1 bound to fragment UB028671
9EJQ 1.87 Å, Crystal structure of DDB1 in complex with XS381952
9BBI 1.9 Å, Co-crystal structure of human DDB1 bound to fragment UB028669
9BZ0 1.9 Å, Structure of an STK19-containing TC-NER complex
9BBE 2.0 Å, Co-crystal structure of human DDB1 bound to fragment UB028668
9BBH 2.0 Å, Co-crystal structure of human DDB1 bound to fragment UB028670
9FJX 2.0 Å, Crystal structure of human CRBN-DDB1 in complex with Lenalidomide
9ZXN 2.07 Å, DDB1 delta with compound 26
37MF 2.1 Å, Crystal structure of DDB1 in complex with XS445479
9ZXM 2.19 Å, DDB1 delta with compound 6
8G46 2.2 Å, Cryo-EM structure of DDB1deltaB-DDA1-DCAF16-BRD4(BD2)-MMH2
8ZSW 2.25 Å, Crystal Structure of Human DDB1, a Component of the E3 Ubiquitin Ligase Complex

Browse structure collections

About this viewer

MolViewer shows 9UWG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.