9UXN: Local refinement of Succinate bound OXGR1

Local refinement of Succinate bound OXGR1. Determined by electron microscopy at 2.7 Å resolution. Released 27 May 2026.

Method: Electron microscopy
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,306
Mol. weight: 38.4 kDa
Ligands: SIN
Released: 27 May 2026

Explore 9UXN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UXN contains 14 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain R: 14 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	29-59	31
α-helix	67-94	28
α-helix	103-136	34
α-helix	142-145	4
α-helix	147-165	19
α-helix	166-169	4
β-strand	174-175	2	1
β-strand	182-183	2	1
α-helix	192-203	12
α-helix	204-208	5
α-helix	209-227	19
α-helix	234-269	36
α-helix	274-292	19
α-helix	294-298	5
α-helix	299-304	6
α-helix	307-312	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
2-oxoglutarate receptor 1	R	protein	337	Homo sapiens	Q96P68 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>9UXN_1 2-oxoglutarate receptor 1 (chains R)
MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIF
KMRPWKSSTIIMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSS
ILFLTCFSIFRYCVIIHPMSCFSIHKTRCAVVACAVVWIISLVAVIPMTFLITSTNRTNR
SACLDLTSSDELNTIKWYNLILTATTFCLPLVIVTLCYTTIIHTLTHGLQTDSCLKQKAR
RLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLL
LYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP

Ligands and cofactors

ID	Name	Formula	Copies
SIN	Succinic acid	C4 H6 O4	1

Primary citation

Molecular architecture of OXGR1 reveals an evolutionary conserved mechanisms for metabolite surveillance. Zhang, X., Lu, Y., He, X. et al. EMBO J (2026) 45:4931-4955. DOI 10.1038/s44318-026-00823-y · PubMed

Other PDB entries of the same protein (UniProt Q96P68 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9VUS 2.37 Å, The structure of akg bound OXGR1
9VMO 2.4 Å, Cryo-EM structure of the ITA-OXGR1-Gq complex
9VMP 2.5 Å, Cryo-EM structure of the A-1-OXGR1-Gq complex
9VMN 2.6 Å, Cryo-EM structure of the a-KG-OXGR1-Gq complex
9VV6 2.62 Å, The structure of ITN bound OXGR1
9M1U 2.64 Å, Cryo-EM structure of Succinic Acid bound OXGR1-Gq complex
9M1S 2.65 Å, Cryo-EM structure of Itaconic acid bound OXGR1-Gq complex
9M1R 2.66 Å, Cryo-EM structure of AKG bound OXGR1-Gq complex
9VO2 2.7 Å, Cryo-EM structure of the OXGR1(CA)-Gq complex
26XH 2.82 Å, Cryo-EM structure of Maleic Acid bound OXGR1-Gq complex
8YYX 2.84 Å, Cryo-EM structure of OXGR1 bound to leukotriene E4 and Gq proteins
9UXQ 2.89 Å, Local refinement of AKG bound OXGR1

Browse structure collections

About this viewer

MolViewer shows 9UXN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.