9VD2: Kelch domain of human KEAP1

Crystal Structure of kelch domain of human KEAP1 in complex with CH7286675. Determined by X-ray diffraction at 1.7 Å resolution. Released 15 Oct 2025.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,606
Mol. weight: 33.42 kDa
Ligands: A1L99
Released: 15 Oct 2025

Explore 9VD2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9VD2 contains 5 α-helices and 42 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 42 β-strands

Element	Residues	Length	Sheet
β-strand	328-331	4	1
β-strand	334-335	2	2
β-strand	337-338	2	2
β-strand	342-346	5	1
β-strand	351-354	4	1
α-helix	356-358	3
β-strand	363	1	3
β-strand	366-370	5	4
β-strand	373-377	5	4
β-strand	380-383	4	3
β-strand	386-389	4	3
β-strand	393-397	5	4
β-strand	402-405	4	4
α-helix	407-409	3
β-strand	414	1	5
β-strand	417-421	5	6
β-strand	424-428	5	6
β-strand	431-432	2	5
β-strand	435-436	2	5
β-strand	440-444	5	6
β-strand	449-453	5	6
α-helix	454-456	3
β-strand	461	1	7
β-strand	464-468	5	8
β-strand	471-475	5	8
β-strand	478	1	7
β-strand	483	1	7
β-strand	487-491	5	8
β-strand	496-500	5	8
α-helix	501-503	3
β-strand	508	1	9
β-strand	511-515	5	10
β-strand	518-522	5	10
β-strand	525	1	9
β-strand	530	1	9
β-strand	534-538	5	10
β-strand	543-546	4	10
α-helix	548-550	3
β-strand	555	1	11
β-strand	558-562	5	12
β-strand	565-569	5	12
β-strand	572	1	11
β-strand	577	1	11
β-strand	580-585	6	12
β-strand	590-596	7	12
β-strand	602	1	2
β-strand	605-608	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kelch-like ECH-associated protein 1	A	protein	293	Homo sapiens	Q14145 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9VD2_1 Kelch-like ECH-associated protein 1 (chains A)
GSHMAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYA
VGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIH
HNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNE
WRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVATATWTFVAPMKHRRSA
LGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT

Ligands and cofactors

ID	Name	Formula	Copies
A1L99	4-[3-[2,6-dichloro-4-(6-methoxy-2-azaspiro[3.3]heptan-2-yl)benzoyl]-2,4-dihydro…	C35 H34 Cl2 F N3 O6	1

Water and common crystallization additives (DMS, ACT) are not listed.

Primary citation

Crystal Structure of kelch domain of human KEAP1 in complex with CH7286675. Kawauchi, H. To be published.

Other PDB entries of the same protein (UniProt Q14145 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8XGK 1.32 Å, Optimization Efforts for Identification of Novel Highly Potent Keap1-Nrf2…
1ZGK 1.35 Å, 1.35 angstrom structure of the Kelch domain of Keap1
8XGV 1.42 Å, Optimization Efforts for Identification of Novel Highly Potent Keap1-Nrf2…
6TYM 1.42 Å, KEAP1 Kelch domain in complex with Compound 9
9KVW 1.44 Å, Crystal Structures of Keap1-compound complexes
8IXS 1.48 Å, Methyl and Fluorine Effects in Novel Orally Bioavailable Keap1/Nrf2 PPI Inhibitor for…
2FLU 1.5 Å, Crystal Structure of the Kelch-Neh2 Complex
8IVR 1.5 Å, Methyl and Fluorine Effects in Novel Orally Bioavailable Keap1/Nrf2 PPI Inhibitor for…
9R1Z 1.5 Å, Keap1 - inhibitor complex - 3
8PKW 1.54 Å, Kelch domain of KEAP1 in complex with a ortho-dimethylbenzene linked cyclic peptide 5…
8PKV 1.55 Å, Kelch domain of KEAP1 in complex with a ortho-dimethylbenzene linked cyclic peptide 4…
9M24 1.57 Å, Crystal Structure of kelch domain of human KEAP1 in complex with CH7450924

Browse structure collections

About this viewer

MolViewer shows 9VD2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.