9VFT: Mature CVA6 virus
Structure of mature CVA6 virus complexed with 3H7 Fab. Determined by electron microscopy at 2.59 Å resolution. Released 19 Nov 2025.
- Method
- Electron microscopy
- Resolution
- 2.59 Å
- Organisms
- Mus musculus, Coxsackievirus A6
- Chains
- 6
- Atoms
- 7,632
- Mol. weight
- 121.29 kDa
- Ligands
- STE
- Released
- 19 Nov 2025
Explore 9VFT in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9VFT contains 33 α-helices and 82 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 13 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-16 | 5 | |
| β-strand | 24 | 1 | 20 |
| β-strand | 28 | 1 | 21 |
| β-strand | 43-44 | 2 | 16 |
| α-helix | 46-48 | 3 | |
| α-helix | 50-52 | 3 | |
| α-helix | 56-58 | 3 | |
| β-strand | 65 | 1 | 21 |
| β-strand | 70 | 1 | 20 |
| α-helix | 72-74 | 3 | |
| β-strand | 75 | 1 | 15 |
| α-helix | 76-80 | 5 | |
| β-strand | 85-91 | 7 | 14 |
| β-strand | 93-94 | 2 | 22 |
| β-strand | 97-98 | 2 | 22 |
| β-strand | 101-105 | 5 | 23 |
| α-helix | 112-118 | 7 | |
| β-strand | 121-135 | 15 | 14 |
| β-strand | 145-151 | 7 | 23 |
| α-helix | 156-158 | 3 | |
| α-helix | 164-167 | 4 | |
| β-strand | 173-177 | 5 | 23 |
| α-helix | 182-183 | 2 | |
| β-strand | 184-187 | 4 | 14 |
| β-strand | 196-197 | 2 | 14 |
| β-strand | 202 | 1 | 13 |
| β-strand | 227-232 | 6 | 23 |
| β-strand | 242-258 | 17 | 14 |
| α-helix | 260-262 | 3 | |
| α-helix | 265-266 | 2 | |
| β-strand | 268 | 1 | 24 |
| β-strand | 271 | 1 | 24 |
| β-strand | 274-275 | 2 | 12 |
| α-helix | 278-280 | 3 | |
| β-strand | 285 | 1 | 17 |
Chain B: 9 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 10 | 1 | 9 |
| β-strand | 14-18 | 5 | 10 |
| β-strand | 21-25 | 5 | 10 |
| β-strand | 32-33 | 2 | 8 |
| α-helix | 34-36 | 3 | |
| α-helix | 44-46 | 3 | |
| α-helix | 52-53 | 2 | |
| β-strand | 54 | 1 | 8 |
| α-helix | 57-60 | 4 | |
| β-strand | 64-71 | 8 | 8 |
| β-strand | 78-81 | 4 | 11 |
| α-helix | 82-85 | 4 | |
| α-helix | 92-98 | 7 | |
| β-strand | 99-111 | 13 | 8 |
| β-strand | 119-128 | 10 | 11 |
| β-strand | 135-136 | 2 | 12 |
| α-helix | 150-153 | 4 | |
| β-strand | 160-161 | 2 | 11 |
| α-helix | 165-167 | 3 | |
| α-helix | 174-179 | 6 | |
| β-strand | 182-186 | 5 | 11 |
| β-strand | 192-197 | 6 | 8 |
| β-strand | 206 | 1 | 8 |
| β-strand | 211 | 1 | 13 |
| β-strand | 214-225 | 12 | 11 |
| β-strand | 234-240 | 7 | 8 |
| β-strand | 242-250 | 9 | 8 |
Chain C: 7 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 23 | 1 | 14 |
| β-strand | 39 | 1 | 14 |
| β-strand | 42 | 1 | 15 |
| α-helix | 44-47 | 4 | |
| β-strand | 51-52 | 2 | 16 |
| β-strand | 58 | 1 | 17 |
| α-helix | 63-66 | 4 | |
| β-strand | 69-72 | 4 | 16 |
| β-strand | 80-85 | 6 | 18 |
| α-helix | 93-96 | 4 | |
| α-helix | 98-102 | 5 | |
| α-helix | 103-105 | 3 | |
| β-strand | 106-110 | 5 | 19 |
| β-strand | 113-120 | 8 | 16 |
| β-strand | 126-134 | 9 | 18 |
| α-helix | 144-147 | 4 | |
| β-strand | 151-156 | 6 | 18 |
| β-strand | 162-165 | 4 | 16 |
| β-strand | 176-177 | 2 | 19 |
| α-helix | 182-187 | 6 | |
| β-strand | 191-201 | 11 | 18 |
| β-strand | 209-218 | 10 | 16 |
| β-strand | 223-227 | 5 | 19 |
Chain D: 2 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 36-38 | 3 | |
| α-helix | 51-54 | 4 | |
| β-strand | 57 | 1 | 8 |
| β-strand | 68 | 1 | 9 |
Chain E: 0 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-6 | 3 | 5 |
| β-strand | 10-13 | 4 | 6 |
| β-strand | 19-25 | 7 | 5 |
| β-strand | 33-38 | 6 | 4 |
| β-strand | 44-46 | 3 | 4 |
| β-strand | 48-49 | 2 | 7 |
| β-strand | 53-54 | 2 | 7 |
| β-strand | 62-67 | 6 | 5 |
| β-strand | 70-75 | 6 | 5 |
| β-strand | 87-90 | 4 | 4 |
| β-strand | 98 | 1 | 4 |
| β-strand | 103-106 | 4 | 6 |
Chain F: 2 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 10-12 | 3 | 2 |
| α-helix | 13 | 1 | |
| β-strand | 19 | 1 | 1 |
| β-strand | 21-25 | 5 | 1 |
| β-strand | 34-40 | 7 | 3 |
| β-strand | 44-51 | 8 | 3 |
| β-strand | 58-59 | 2 | 3 |
| β-strand | 69-73 | 5 | 1 |
| β-strand | 78-82 | 5 | 1 |
| α-helix | 88-90 | 3 | |
| β-strand | 95-98 | 4 | 3 |
| β-strand | 113 | 1 | 4 |
| β-strand | 120-122 | 3 | 2 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| VH | F | protein | 124 | Mus musculus | |
| VL | E | protein | 107 | Mus musculus | |
| Genome polyprotein | D | protein | 69 | Coxsackievirus A6 | E3VJS6 |
| Genome polyprotein | B | protein | 256 | Coxsackievirus A6 | A0A7D0TR32 |
| Genome polyprotein | C | protein | 240 | Coxsackievirus A6 | A0A4P2SK07 |
| Genome polyprotein | A | protein | 305 | Coxsackievirus A6 | A0A222NWY2 |
Sequence of entity 1 (F), FASTA
>9VFT_1 VH (chains F)
EVKLVESGGGLVKPGGSLKLSCAASGFAFSTYDMSWVRQTPEKRLEWVATISSGGSYTYY
PDSVKGRFTISRDNARNTLYLQMSSLRSEDTALYYCARGGPYDYDGSFYTMDYWGQGTSV
TVSS
Sequence of entity 2 (E), FASTA
>9VFT_2 VL (chains E)
DIQMTQSPSSLSASLGERVSLTCRASQDIGSRLNWLQQEPDGTIKRLIYATSSLDSGVPK
RFSGSRSGSYYSLTISSLESEDFVDYYCLQYAGFPWTFGGGTKLEIK
Sequence of entity 3 (D), FASTA
>9VFT_3 Genome polyprotein (chains D)
MGAQVSTQKSGSHETRNVATEGSTINFTNINYYKDSYAASASRQDFAQDPAKFTRPVLDA
IREAAAPLQ
Sequence of entity 4 (B), FASTA
>9VFT_4 Genome polyprotein (chains B)
SPSVEACGYSDRVAQLTVGNSTITTQEAANIVLSYGEWPEYCPSTDATAVDKPTRPDVSV
NRFYTLSTKSWKTESTGWYWKFPDVLNDTGVFGQNAQFHYLYRSGFCMHVQCNASKFHQG
ALLVAAIPEFVIAASSPATKPNSQGLYPDFAHTNPGKDGQEFRDPYVLDAGIPLSQALIF
PHQWINLRTNNCATIIMPYINALPFDSALNHSNFGLVVIPISPLKYCNGATTEVPITLTI
APLNSEFSGLRQAIKQ
Sequence of entity 5 (C), FASTA
>9VFT_5 Genome polyprotein (chains C)
GFPTELKPGTNQFLTTDDGTSPPILPGFEPTPLIHIPGEFTSLLDLCQVETILEVNNTTG
TTGVSRLLIPVRAQNNVDQLCASFQVDPGRNGPWQSTMVGQICRYYTQWSGSLKVTFMFT
GSFMATGKMLIAYTPPGSAQPTTREAAMLGTHIVWDFGLQSSVTLVIPWISNTHFRAVKT
GGVYDYYATGIVTIWYQTNFVVPPDTPTEANIIALGAAQKNFTLKLCKDTDEIQQTAEYQ
Sequence of entity 6 (A), FASTA
>9VFT_6 Genome polyprotein (chains A)
NDPITNAVESAVSALADTTISRVTAANTAASTHSLGTGRVPALQAAETGASSNSSDENLI
ETRCVMNRNGVNEASVEHFYSRAGLVGVVEVKDSGTSLDGYTVWPIDVMGFVQQRRKLEL
STYMRFDAEFTFVSNLNNSTTPGMLLQYMYVPPGAPKPDSRKSYQWQTATNPSVFAKLSD
PPPQVSVPFMSPATAYQWFYDGYPTFGEHKQATNLQYGQCPNNMMGHFAIRTVSESTTGK
NIHVRVYMRIKHVRAWVPRPLRSQAYMVKNYPTYSQTITNTATDRASITTTDYEGGVPAS
PQRTS
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| STE | Stearic acid | C18 H36 O2 | 1 |
Primary citation
Molecular mechanisms of receptor recognition and antibody neutralization of coxsackievirus A6. Ke, X., Li, X., Liu, Z. et al. Nat Commun (2025) 17:934-934. DOI 10.1038/s41467-025-67666-9 · PubMed
Other PDB entries of the same protein (UniProt E3VJS6), best resolution first:
- 9VFU 2.11 Å, Structure of mature CVA6 virus complexed with 1F4 Fab
- 9VFQ 2.23 Å, Structure of mature CVA6 virus
- 9VFR 2.55 Å, Structure of mature Coxsackievirus A6 virion complexed with its receptor KREMEN1
Browse structure collections
About this viewer
MolViewer shows 9VFT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.