9W1U: Mutant apo LC3B

Crystal structure of mutant apo LC3B. Determined by X-ray diffraction at 1.6 Å resolution. Released 29 Jul 2026.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,193
Mol. weight: 15.83 kDa
Released: 29 Jul 2026

Explore 9W1U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9W1U contains 6 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	1
α-helix	38	1
α-helix	45-47	3
β-strand	51-55	5	1
β-strand	59	1	2
α-helix	60-71	12
β-strand	80-83	4	1
β-strand	86	1	1
β-strand	94	1	2
α-helix	95-102	8
β-strand	109-114	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated protein 1 light chain 3 beta	A	protein	131	Mus musculus	Q9CQV6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9W1U_1 Microtubule-associated protein 1 light chain 3 beta (chains A)
HHHHHHMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLV
PDHVNMSELKKIIRRRLQLNANQAFFLLVNGHSMDSFSTPISEVYESERDEDGFLYMVYA
SQETFGTAMAV

Primary citation

A programmable lipid-triggered allosteric site modulates LC3 LIR receptor binding activity. Gahlot, D., Castin, J., Mathur, S. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-76697-9 · PubMed

Other PDB entries of the same protein (UniProt Q9CQV6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9W2N 1.67 Å, Crystal structure of the mutant LC3B in complex with p62
5WRD 1.9 Å, Crystal structure of LC3B in complex with FYCO1 LIR
5YIS 2.2 Å, Crystal Structure of AnkB LIR/LC3B complex
5YIQ 2.6 Å, Crystal structure of AnkG LIR/LC3B complex

Browse structure collections

About this viewer

MolViewer shows 9W1U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.