9WSV: DAMGO-muOR-arrestin-1-Fab30 complex

Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex. Determined by electron microscopy at 2.8 Å resolution. Released 26 Nov 2025.

Method: Electron microscopy
Resolution: 2.8 Å
Organisms: Mus musculus, Homo sapiens, Bos taurus
Chains: 5
Atoms: 7,639
Mol. weight: 136.86 kDa
Released: 26 Nov 2025

Explore 9WSV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9WSV contains 35 α-helices and 66 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 7 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	2
β-strand	19-22	4	2
β-strand	26-28	3	3
β-strand	29	1	4
β-strand	34	1	4
α-helix	35-36	2
β-strand	37-42	6	2
β-strand	52-62	11	5
β-strand	76-87	12	5
α-helix	99-107	9
β-strand	112-117	6	2
β-strand	128-131	4	6
β-strand	140-141	2	6
β-strand	142-151	10	5
α-helix	157-159	3
β-strand	163-168	6	5
β-strand	169-171	3	3
α-helix	180-182	3
β-strand	183-188	6	7
α-helix	196	1
β-strand	197-203	7	7
β-strand	207-209	3	8
β-strand	214-222	9	7
β-strand	228-242	15	9
β-strand	249-258	10	9
β-strand	262	1	9
β-strand	266-274	9	7
β-strand	285-289	5	6
β-strand	300	1	6
α-helix	301-305	5
β-strand	316-330	15	9
β-strand	340-349	10	9
β-strand	350-352	3	8
α-helix	353-357	5

Chain H: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	10
β-strand	14	1	11
β-strand	21-28	8	10
β-strand	35-42	8	12
β-strand	48-55	8	12
β-strand	60-63	4	12
β-strand	71-76	6	10
β-strand	81-86	6	10
α-helix	91-93	3
β-strand	95-103	9	12
β-strand	112-113	2	12
β-strand	117-119	3	12
β-strand	120	1	11
α-helix	128-129	2
β-strand	130-133	4	13
β-strand	149-153	5	13
α-helix	159	1
β-strand	160-164	5	14
α-helix	165-167	3
β-strand	173-180	8	13
β-strand	186-192	7	13
β-strand	206-210	5	14
β-strand	215-219	5	14

Chain L: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	15
β-strand	11-14	4	16
α-helix	18-19	2
β-strand	20-26	7	15
β-strand	34-39	6	16
β-strand	46-50	5	16
β-strand	54-55	2	16
α-helix	56	1
β-strand	63-68	6	15
β-strand	71-76	6	15
α-helix	81-83	3
β-strand	86-91	6	16
α-helix	97	1
β-strand	98	1	16
β-strand	103-107	5	16
β-strand	112	1	17
β-strand	115-119	5	18
α-helix	120-122	3
α-helix	123-126	4
β-strand	133-140	8	18
β-strand	141	1	17
α-helix	159-160	2
β-strand	161-164	4	18
α-helix	166-168	3
β-strand	174-180	7	18

Chain R: 16 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	66-91	26
α-helix	92-97	6
α-helix	102-118	17
α-helix	121-129	9
α-helix	137-170	34
α-helix	172-178	7
α-helix	181-204	24
α-helix	207	1
β-strand	208	1	1
α-helix	209	1
β-strand	217	1	1
α-helix	225-237	13
α-helix	238-242	5
α-helix	243-260	18
α-helix	271-305	35
α-helix	312-332	21
α-helix	333-337	5
α-helix	341-350	10
β-strand	368-371	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mu-type opioid receptor,Vasopressin V2 receptor	R	protein	386	Mus musculus, Homo sapiens	P30518 (AlphaFold model), P42866 (AlphaFold model)
Beta-arrestin-1	C	protein	393	Bos taurus	P17870 (AlphaFold model)
Fab30 heavy chain	H	protein	236	synthetic construct
Fab30 light chain	L	protein	216	synthetic construct
Damgo	P	protein	5	synthetic construct

Sequence of entity 1 (R), FASTA

>9WSV_1 Mu-type opioid receptor,Vasopressin V2 receptor (chains R)
GPMGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGS
PSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLP
FQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPR
NAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFI
MPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVII
KALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCICARGRTPPSL
GPQDESCTTASSSLAKDTSSLEVLFQ

Sequence of entity 2 (C), FASTA

>9WSV_2 Beta-arrestin-1 (chains C)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIEKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPEHETPVDTNLIELDTNDDDAAAEDFAR

Sequence of entity 3 (H), FASTA

>9WSV_3 Fab30 heavy chain (chains H)
MEISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYG
YTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV
LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTENLYFQ

Sequence of entity 4 (L), FASTA

>9WSV_4 Fab30 light chain (chains L)
MSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV
PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIF
PPSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST
LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 5 (P), FASTA

>9WSV_5 DAMGO (chains P)
YAGFX

Primary citation

The molecular basis of mu-opioid receptor signaling plasticity. Zhang, H., Wang, X., Xi, K. et al. Cell Res (2025) 35:1021-1036. DOI 10.1038/s41422-025-01191-8 · PubMed

Other PDB entries of the same protein (UniProt P30518 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DFC 2.49 Å, Crystal of Arrestin2-V2Rpp-3-Fab30 complex
9HAP 2.5 Å, Cryo-EM structure of inactive human arginine-vasopressin (AVP) V2 receptor (V2R) with…
9HB3 2.5 Å, cryo-EM structure of inactive human arginine-vasopressin (AVP) V2 receptor (V2R) with…
7DFA 2.54 Å, Crystal of Arrestin2-V2Rpp-4-Fab30 complex
4JQI 2.6 Å, Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
7DW9 2.6 Å, Cryo-EM structure of human V2 vasopressin receptor in complex with an Gs protein
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
7KH0 2.8 Å, Cryo-EM structure of the human arginine vasopressin AVP-vasopressin receptor V2R-Gs…
9WSW 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-Gz-scFv16 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex
9UVW 2.89 Å, Cryo-EM structure of Vasopressin receptor 2 (V2R)-BRIL/anti BRIL SRP2070 Fab antibody…

Browse structure collections

About this viewer

MolViewer shows 9WSV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.