Crystal structure of NRas-G12D in complex with GDP and IACS-56676. Determined by X-ray diffraction at 1.72 Å resolution. Released 25 Feb 2026.
Explore 9Y1X in 3D Show helices and sheets RCSB PDB PDBe
9Y1X contains 10 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-9 | 8 | 1 |
| α-helix | 16-25 | 10 | |
| β-strand | 37-46 | 10 | 1 |
| β-strand | 49-57 | 9 | 1 |
| α-helix | 66-73 | 8 | |
| β-strand | 77-83 | 7 | 1 |
| α-helix | 87-104 | 18 | |
| β-strand | 111-116 | 6 | 1 |
| α-helix | 127-137 | 11 | |
| β-strand | 141-143 | 3 | 1 |
| α-helix | 152-167 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-9 | 7 | 1 |
| α-helix | 16-25 | 10 | |
| β-strand | 37-46 | 10 | 1 |
| β-strand | 49-57 | 9 | 1 |
| α-helix | 66-74 | 9 | |
| β-strand | 77-83 | 7 | 1 |
| α-helix | 87-103 | 17 | |
| β-strand | 111-116 | 6 | 1 |
| α-helix | 127-137 | 11 | |
| β-strand | 141-143 | 3 | 1 |
| α-helix | 152-168 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| GTPase NRas | A, B | protein | 171 | Homo sapiens | P01111 (AlphaFold model) |
>9Y1X_1 GTPase NRas (chains A, B) GPMTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDT AGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKS DLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMK
| ID | Name | Formula | Copies |
|---|---|---|---|
| GDP | Guanosine-5'-diphosphate | C10 H15 N5 O11 P2 | 2 |
| A1CRW | N-({(6P)-6-[5-amino-3-chloro-2-(trifluoromethyl)phenyl]-3-[(1R,5S,6s)-3-azabicy… | C28 H28 Cl F4 N5 O | 2 |
| MG | Magnesium ion | Mg | 3 |
| CIT | Citric acid | C6 H8 O7 | 1 |
Structure-Guided Development of NRAS G12D Inhibitors Based on a 5‐Azaindole Core. Cox, J.B., Nair, V., Mandal, P. et al. ACS Med Chem Lett (2026) 17:425-432. DOI 10.1021/acsmedchemlett.5c00647 · PubMed
Other PDB entries of the same protein (UniProt P01111 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9Y1X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.