9Z04: Lymphoid-specific helicase
Structure of human lymphoid-specific helicase HELLS in its auto-inhibitory state. Determined by electron microscopy at 2.99 Å resolution. Released 29 Apr 2026.
- Method
- Electron microscopy
- Resolution
- 2.99 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 16,158
- Mol. weight
- 583.31 kDa
- Released
- 29 Apr 2026
Explore 9Z04 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9Z04 contains 95 α-helices and 66 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 16 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-101 | 74 | |
| α-helix | 225-238 | 14 | |
| β-strand | 244-246 | 3 | 1 |
| α-helix | 248-249 | 2 | |
| α-helix | 255-267 | 13 | |
| β-strand | 274-278 | 5 | 1 |
| α-helix | 280-282 | 3 | |
| α-helix | 283-293 | 11 | |
| β-strand | 299-301 | 3 | 1 |
| α-helix | 306-312 | 7 | |
| α-helix | 313-315 | 3 | |
| β-strand | 320 | 1 | 2 |
| β-strand | 325 | 1 | 2 |
| β-strand | 328-332 | 5 | 1 |
| α-helix | 333-338 | 6 | |
| α-helix | 342-344 | 3 | |
| β-strand | 348 | 1 | 3 |
| β-strand | 350-354 | 5 | 1 |
| α-helix | 363-370 | 8 | |
| β-strand | 375 | 1 | 3 |
| β-strand | 378-381 | 4 | 1 |
| α-helix | 390-400 | 11 | |
| α-helix | 411-422 | 12 | |
| α-helix | 427-444 | 18 | |
| α-helix | 445-447 | 3 | |
| β-strand | 448-449 | 2 | 1 |
| α-helix | 453-456 | 4 | |
Chain B: 16 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-101 | 74 | |
| α-helix | 225-238 | 14 | |
| β-strand | 244-246 | 3 | 4 |
| α-helix | 248-249 | 2 | |
| α-helix | 255-267 | 13 | |
| β-strand | 274-278 | 5 | 4 |
| α-helix | 280-282 | 3 | |
| α-helix | 283-293 | 11 | |
| β-strand | 299-301 | 3 | 4 |
| α-helix | 306-310 | 5 | |
| α-helix | 313-315 | 3 | |
| β-strand | 320 | 1 | 5 |
| β-strand | 325 | 1 | 5 |
| β-strand | 328-332 | 5 | 4 |
| α-helix | 333-338 | 6 | |
| α-helix | 342-344 | 3 | |
| β-strand | 348 | 1 | 6 |
| β-strand | 350-354 | 5 | 4 |
| α-helix | 363-370 | 8 | |
| β-strand | 375 | 1 | 6 |
| β-strand | 378-381 | 4 | 4 |
| α-helix | 390-400 | 11 | |
| α-helix | 411-422 | 12 | |
| α-helix | 427-444 | 18 | |
| α-helix | 445-447 | 3 | |
| β-strand | 448-449 | 2 | 4 |
| α-helix | 453-456 | 4 | |
Chain C: 16 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-101 | 74 | |
| α-helix | 225-238 | 14 | |
| β-strand | 244-246 | 3 | 7 |
| α-helix | 248-249 | 2 | |
| α-helix | 254-267 | 14 | |
| β-strand | 274-278 | 5 | 7 |
| α-helix | 280-282 | 3 | |
| α-helix | 283-293 | 11 | |
| β-strand | 299-302 | 4 | 7 |
| α-helix | 306-312 | 7 | |
| α-helix | 313-315 | 3 | |
| β-strand | 320 | 1 | 8 |
| β-strand | 325 | 1 | 8 |
| β-strand | 328-332 | 5 | 7 |
| α-helix | 333-338 | 6 | |
| α-helix | 342-344 | 3 | |
| β-strand | 348 | 1 | 9 |
| β-strand | 350-354 | 5 | 7 |
| α-helix | 363-370 | 8 | |
| β-strand | 375 | 1 | 9 |
| β-strand | 378-381 | 4 | 7 |
| α-helix | 390-400 | 11 | |
| α-helix | 411-422 | 12 | |
| α-helix | 427-444 | 18 | |
| α-helix | 445-447 | 3 | |
| β-strand | 448-449 | 2 | 7 |
| α-helix | 453-456 | 4 | |
Chain D: 15 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-101 | 74 | |
| α-helix | 225-238 | 14 | |
| β-strand | 244-246 | 3 | 10 |
| α-helix | 248-249 | 2 | |
| α-helix | 254-267 | 14 | |
| β-strand | 274-278 | 5 | 10 |
| α-helix | 280-282 | 3 | |
| α-helix | 283-293 | 11 | |
| β-strand | 299-302 | 4 | 10 |
| α-helix | 306-310 | 5 | |
| α-helix | 313-315 | 3 | |
| β-strand | 320 | 1 | 11 |
| β-strand | 325 | 1 | 11 |
| β-strand | 328-332 | 5 | 10 |
| α-helix | 333-338 | 6 | |
| β-strand | 348 | 1 | 12 |
| β-strand | 350-354 | 5 | 10 |
| α-helix | 363-370 | 8 | |
| β-strand | 375 | 1 | 12 |
| β-strand | 378-381 | 4 | 10 |
| α-helix | 390-400 | 11 | |
| α-helix | 411-422 | 12 | |
| α-helix | 427-444 | 18 | |
| α-helix | 445-447 | 3 | |
| β-strand | 448-449 | 2 | 10 |
| α-helix | 453-456 | 4 | |
Chain E: 15 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-101 | 74 | |
| α-helix | 225-238 | 14 | |
| β-strand | 244-246 | 3 | 13 |
| α-helix | 248-249 | 2 | |
| α-helix | 254-267 | 14 | |
| β-strand | 274-278 | 5 | 13 |
| α-helix | 283-293 | 11 | |
| β-strand | 299-302 | 4 | 13 |
| α-helix | 306-312 | 7 | |
| α-helix | 313-315 | 3 | |
| β-strand | 320 | 1 | 14 |
| β-strand | 325 | 1 | 14 |
| β-strand | 328-332 | 5 | 13 |
| α-helix | 333-338 | 6 | |
| α-helix | 342-344 | 3 | |
| β-strand | 348 | 1 | 15 |
| β-strand | 350-354 | 5 | 13 |
| α-helix | 363-370 | 8 | |
| β-strand | 375 | 1 | 15 |
| β-strand | 378-381 | 4 | 13 |
| α-helix | 390-400 | 11 | |
| α-helix | 411-422 | 12 | |
| α-helix | 427-444 | 18 | |
| α-helix | 445-447 | 3 | |
| β-strand | 448-449 | 2 | 13 |
| α-helix | 453-456 | 4 | |
Chain F: 17 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-57 | 30 | |
| α-helix | 59-101 | 43 | |
| α-helix | 225-238 | 14 | |
| β-strand | 244-246 | 3 | 16 |
| α-helix | 248-249 | 2 | |
| α-helix | 254-267 | 14 | |
| β-strand | 274-278 | 5 | 16 |
| α-helix | 280-282 | 3 | |
| α-helix | 283-293 | 11 | |
| β-strand | 299-302 | 4 | 16 |
| α-helix | 306-312 | 7 | |
| α-helix | 313-315 | 3 | |
| β-strand | 320 | 1 | 17 |
| β-strand | 325 | 1 | 17 |
| β-strand | 328-332 | 5 | 16 |
| α-helix | 333-338 | 6 | |
| α-helix | 342-344 | 3 | |
| β-strand | 348 | 1 | 18 |
| β-strand | 350-354 | 5 | 16 |
| α-helix | 363-370 | 8 | |
| β-strand | 375 | 1 | 18 |
| β-strand | 378-381 | 4 | 16 |
| α-helix | 390-400 | 11 | |
| α-helix | 411-422 | 12 | |
| α-helix | 427-444 | 18 | |
| α-helix | 445-447 | 3 | |
| β-strand | 448-449 | 2 | 16 |
| α-helix | 453-456 | 4 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Lymphoid-specific helicase | A, B, C, D, E, F | protein | 838 | Homo sapiens | Q9NRZ9 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>9Z04_1 Lymphoid-specific helicase (chains A, B, C, D, E, F)
MPAERPAGSGGSEAPAMVEQLDTAVITPAMLEEEEQLEAAGLERERKMLEKARMSWDRES
TEIRYRRLQHLLEKSNIYSKFLLTKMEQQQLEEQKKKEKLERKKESLKVKKGKNSIDASE
EKPVMRKKRGREDESYNISEVMSKEEILSVAKKNKKENEDENSSSTNLCVEDLQKNKDSN
SIIKDRLSETVRQNTKFFFDPVRKCNGQPVPFQQPKHFTGGVMRWYQVEGMEWLRMLWEN
GINGILADEMGLGKTVQCIATIALMIQRGVPGPFLVCGPLSTLPNWMAEFKRFTPDIPTM
LYHGTQEERQKLVRNIYKRKGTLQIHPVVITSFEIAMRDRNALQHCYWKYLIVDEGHRIK
NMKCRLIRELKRFNADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSL
SETAEDIIAKEREQNVLHMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLSKKQEIFY
TAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVD
RERAVVEVNIPVESEVNLKLQNIMMLLRKCCNHPYLIEYPIDPVTQEFKIDEELVTNSGK
FLILDRMLPELKKRGHKVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHS
FNTDPEVFIFLVSTRAGGLGINLTAADTVIIYDSDWNPQSDLQAQDRCHRIGQTKPVVVY
RLVTANTIDQKIVERAAAKRKLEKLIIHKNHFKGGQSGLNLSKNFLDPKELMELLKSRDY
EREIKGSREKVISDKDLELLLDRSDLIDQMNASGPIKEKMGIFKILENSEDSSPECLF
Primary citation
Structure of human lymphoid-specific helicase HELLS in its autoinhibited state. Kaur, G., Ren, R., Lee, J. et al. Nucleic Acids Res (2026) 54. DOI 10.1093/nar/gkag326 · PubMed
Other PDB entries of the same protein (UniProt Q9NRZ9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9Z05 2.86 Å, Structure of human lymphoid-specific helicase HELLS in its auto-inhibitory state (D3)
- 9Z06 3.39 Å, Structure of human lymphoid-specific helicase HELLS in its auto-inhibitory state
- 8SKZ 3.5 Å, Cryo-EM structure of DDM1-HELLS chimera bound to the nucleosome
Browse structure collections
About this viewer
MolViewer shows 9Z04 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.