10FD: SK5G-Matured

SK5G-Matured in complex with GluN1-GluN2B, full refinement. Determined by electron microscopy at 3.09 Å resolution. Released 25 Mar 2026.

Method: Electron microscopy
Resolution: 3.09 Å
Organisms: Homo sapiens, Mus musculus
Chains: 8
Atoms: 26,715
Mol. weight: 426.72 kDa
Released: 25 Mar 2026

Explore 10FD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

10FD contains 125 α-helices and 201 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	26-32	7	1
α-helix	36-52	17
β-strand	59-64	6	1
α-helix	71-81	11
α-helix	83-85	3
β-strand	87-92	6	1
α-helix	105-110	6
β-strand	118-120	3	1
α-helix	127-129	3
β-strand	138-139	2	1
α-helix	144-148	5
α-helix	150-157	8
β-strand	164-168	5	2
α-helix	173-186	14
β-strand	193-197	5	2
β-strand	218-222	5	2
α-helix	228-234	7
β-strand	246-248	3	2
α-helix	252-254	3
β-strand	267-268	2	2
β-strand	271	1	3
α-helix	277-297	21
α-helix	318-326	9
β-strand	340	1	4
β-strand	346	1	4
β-strand	351	1	3
β-strand	354-356	3	2
β-strand	361-363	3	2
β-strand	365-367	3	3
β-strand	372-374	3	3
α-helix	377-379	3
β-strand	397-402	6	5
β-strand	405	1	6
β-strand	409	1	6
β-strand	410-413	4	5
α-helix	414-415	2
α-helix	420-422	3
β-strand	424	1	7
β-strand	430	1	7
α-helix	431-432	2
β-strand	434-438	5	5
β-strand	451-456	6	5
α-helix	458-470	13
β-strand	473-478	6	5
β-strand	487-489	3	8
α-helix	490	1
β-strand	496-498	3	8
β-strand	512-518	7	5
β-strand	527-529	3	5
β-strand	534	1	5
β-strand	538-543	6	9
α-helix	544-545	2
α-helix	560-580	21
α-helix	603-614	12
α-helix	627-656	30
β-strand	682	1	9
β-strand	684	1	10
α-helix	688-694	7
α-helix	697-699	3
α-helix	700-706	7
β-strand	711	1	10
α-helix	718-722	5
β-strand	729-732	4	9
α-helix	733-742	10
β-strand	746-753	8	9
β-strand	758-763	6	5
α-helix	811-813	3
α-helix	814-840	30

Chain B: 25 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	34-42	9	11
β-strand	65-73	9	11
α-helix	78-91	14
β-strand	97-101	5	11
α-helix	108-119	12
β-strand	123-127	5	11
α-helix	128-131	4
β-strand	143-145	3	11
α-helix	156-161	6
β-strand	171-173	3	12
α-helix	179-191	13
β-strand	208	1	12
α-helix	215-219	5
β-strand	227-231	5	12
α-helix	238-247	10
β-strand	255-258	4	12
α-helix	260-263	4
α-helix	274	1
β-strand	278-282	5	12
α-helix	289-294	6
α-helix	297-300	4
α-helix	315-317	3
α-helix	330-339	10
β-strand	343	1	13
β-strand	348	1	13
β-strand	351	1	14
β-strand	357	1	14
β-strand	362-367	6	12
β-strand	373-375	3	12
β-strand	377-379	3	12
β-strand	384-386	3	12
β-strand	405-410	6	15
β-strand	413	1	16
β-strand	417	1	16
β-strand	418-420	3	17
β-strand	434-435	2	17
β-strand	438	1	18
β-strand	453	1	18
β-strand	456-458	3	17
α-helix	460-468	9
β-strand	475-480	6	15
β-strand	490	1	19
β-strand	493	1	19
α-helix	498-502	5
β-strand	508-509	2	15
β-strand	514	1	20
β-strand	524-525	2	15
β-strand	530-532	3	20
β-strand	534-539	6	21
α-helix	540-542	3
α-helix	557-578	22
α-helix	602-613	12
α-helix	626-655	30
α-helix	669-672	4
β-strand	683-684	2	21
α-helix	690-698	9
α-helix	714-718	5
β-strand	728-732	5	21
β-strand	748-750	3	21
β-strand	760-762	3	20
β-strand	765-766	2	15
α-helix	773-784	12
α-helix	788-796	9
α-helix	820-842	23

Chain C: 35 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	26-33	8	22
α-helix	36-52	17
β-strand	59-66	8	22
α-helix	67-68	2
α-helix	71-77	7
α-helix	78-82	5
α-helix	83-85	3
β-strand	87-92	6	22
α-helix	105-113	9
β-strand	118-120	3	22
α-helix	126-129	4
β-strand	137-139	3	22
α-helix	142-143	2
α-helix	144-147	4
α-helix	148-156	9
β-strand	163-168	6	23
α-helix	171-183	13
β-strand	193-197	5	23
α-helix	206-210	5
β-strand	218-221	4	23
α-helix	227-237	11
β-strand	246-248	3	23
α-helix	256-258	3
β-strand	267	1	23
β-strand	270-271	2	24
α-helix	277-297	21
α-helix	302-305	4
α-helix	317-327	11
β-strand	331	1	25
β-strand	337	1	25
β-strand	340	1	26
β-strand	346	1	26
β-strand	351-356	6	24
β-strand	361-367	7	24
β-strand	372-373	2	24
α-helix	377-379	3
α-helix	388-390	3
β-strand	397-402	6	27
β-strand	410-413	4	28
α-helix	414-415	2
β-strand	424	1	29
β-strand	430	1	29
α-helix	431-432	2
β-strand	434-438	5	28
β-strand	451-456	6	28
α-helix	458-470	13
β-strand	473-478	6	27
β-strand	486-489	4	30
β-strand	496-499	4	30
β-strand	512-518	7	27
α-helix	519	1
β-strand	527-529	3	27
β-strand	534	1	27
β-strand	538-543	6	31
α-helix	544-547	4
α-helix	560-583	24
α-helix	605-613	9
α-helix	628-657	30
α-helix	670-673	4
β-strand	681-682	2	31
β-strand	684	1	32
α-helix	688-693	6
α-helix	697-699	3
α-helix	700-706	7
β-strand	711	1	32
α-helix	717-720	4
β-strand	728-732	5	31
β-strand	746-753	8	31
β-strand	758-763	6	27
α-helix	771-780	10
α-helix	805-807	3
α-helix	814-840	30

Chain D: 32 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	37-42	6	33
α-helix	54-56	3
β-strand	68-73	6	33
α-helix	78-91	14
β-strand	97-100	4	33
α-helix	108-119	12
β-strand	123-125	3	33
α-helix	128-131	4
β-strand	143-145	3	33
α-helix	159-164	6
β-strand	170-172	3	34
α-helix	180-190	11
β-strand	208-209	2	34
α-helix	217-220	4
β-strand	227-229	3	34
α-helix	234-244	11
β-strand	255-258	4	34
α-helix	260-263	4
α-helix	274	1
β-strand	278-282	5	34
α-helix	289-311	23
α-helix	330-332	3
α-helix	335-338	4
β-strand	342-344	3	35
β-strand	347-349	3	35
β-strand	351	1	36
β-strand	357	1	36
β-strand	362-367	6	34
β-strand	373-378	6	34
β-strand	379-380	2	37
β-strand	383-384	2	37
β-strand	405-409	5	38
β-strand	413	1	39
β-strand	417	1	39
β-strand	418-420	3	40
α-helix	421-423	3
β-strand	434-436	3	40
β-strand	437	1	41
β-strand	455-458	4	40
α-helix	462-472	11
β-strand	475-478	4	38
β-strand	479	1	41
β-strand	489-490	2	42
β-strand	493-494	2	42
β-strand	508-509	2	38
β-strand	514	1	43
α-helix	519-521	3
β-strand	524-525	2	44
β-strand	531-537	7	45
α-helix	556-576	21
α-helix	602-613	12
α-helix	626-655	30
α-helix	657-659	3
α-helix	669-672	4
α-helix	674-676	3
α-helix	680-681	2
β-strand	683-684	2	45
α-helix	691-697	7
α-helix	701-705	5
α-helix	714-722	9
β-strand	728-732	5	45
β-strand	757-761	5	45
β-strand	762	1	43
β-strand	765-766	2	44
α-helix	767	1
α-helix	773-785	13
α-helix	792-795	4
α-helix	815-818	4
α-helix	821-831	11
α-helix	834-844	11

Chain E: 0 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	46
β-strand	10-13	4	47
β-strand	22-24	3	46
β-strand	30-31	2	48
β-strand	36-37	2	48
β-strand	40-44	5	49
β-strand	51-54	4	49
β-strand	68-69	2	50
β-strand	72-73	2	46
β-strand	76-77	2	46
β-strand	80-81	2	50
β-strand	91-95	5	49
β-strand	108	1	49
β-strand	109-112	4	47

Chain F: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	51
β-strand	17-23	7	51
β-strand	27	1	33
β-strand	34-40	7	52
β-strand	44-47	4	52
β-strand	51	1	52
β-strand	68-73	6	51
β-strand	78-84	7	51
α-helix	88-90	3
β-strand	93-99	7	52
α-helix	100	1
β-strand	106-109	4	52

Chain I: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	53
β-strand	11-13	3	54
β-strand	19-22	4	55
β-strand	24-25	2	53
β-strand	39-44	6	56
β-strand	50-55	6	56
β-strand	59-60	2	56
α-helix	61	1
β-strand	68-71	4	55
β-strand	78-81	4	55
β-strand	91-96	6	56
β-strand	110-112	3	54

Chain J: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	57
β-strand	10	1	58
β-strand	18-19	2	57
β-strand	23-25	3	57
β-strand	34-39	6	59
β-strand	45-52	8	59
β-strand	57-60	4	59
β-strand	69-73	5	57
β-strand	78-83	6	57
β-strand	93-99	7	59
α-helix	100	1
β-strand	106-109	4	59
β-strand	113-114	2	59
β-strand	115	1	58

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate receptor ionotropic, NMDA 1	A, C	protein	844	Homo sapiens	Q05586 (AlphaFold model)
Glutamate receptor ionotropic, NMDA 2B	B, D	protein	826	Homo sapiens	Q13224 (AlphaFold model)
Light chain	E, I	protein	113	Mus musculus
Heavy chain	F, J	protein	118	Mus musculus

Sequence of entity 1 (A, C), FASTA

>10FD_1 Glutamate receptor ionotropic, NMDA 1 (chains A, C)
MSTMHLLTFALLFSCSFARAASDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRL
ETLLEERESKAEKVLQFDPGTKNVTALLMEARELEARVIILSASEDDAATVYRAAAMLNM
TGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQAVHELLEKEN
ITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRK
LVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTC
KEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVA
DGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTI
LVKKEIPRSTLDSFMNPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDA
LTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRP
EERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQA
VRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSH
ENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMIVAGGIVAGIFLIFIEIAYKRH
KSRA

Sequence of entity 2 (B, D), FASTA

>10FD_2 Glutamate receptor ionotropic, NMDA 2B (chains B, D)
RSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFHHLSVVPRVELVAMNETDPKSIITRIC
DLMSDRKIQGVVFADDTDQEAIAQILDFISAQTLTPILGIHGGSSMIMADKDESSMFFQF
GPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLD
MSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTWIVPSLVAGDT
DTVPSEFPTGLISVSYDEWDYGLPARVRDGIAIITTAASDMLSEHSFIPEPKSSCYNTHE
KRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHPKLVIILLNKERKWERVGKWKDKSLQM
KYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVESVDPLSGTCMRNTVPCEKRIVTENKT
DEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVMKRA
YMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVML
LIVSAVAVFVFEYFSPVGYNRSLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGT
TSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPPFRFGTV
PNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLSLKTGKLDAFIYDAAVLNYMAGRDEGC
KLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWLTGICHNEKN
EVMSSQLDIDNMAGVFYMLGAAMALSLITFISEHLFYWQFRHSFMG

Sequence of entity 3 (E, I), FASTA

>10FD_3 Light chain (chains E, I)
DIVMTQSPSSLAMSVGQKVTMSCRSSQSLLKSSTQKNYLAWYQQKPGQSPKLLLYFASTR
ESGVPDRFIGSGSGTDFTLTISSVQAEDLADYFCQQHYTTPWTFGGGTKLEIK

Sequence of entity 4 (F, J), FASTA

>10FD_4 Heavy chain (chains F, J)
QVQLQQPGAELVRPGASVKLSCKASGYSFTSYWMNWVKQRPGQGLEWIGMIHPSDSETKL
NQKFKDKATLTVDKSSSTAYMQLSSPTSEDSAVYYCARQDWTGAWFAYWGQGTLVTVS

Primary citation

Ectopic NMDAR expression in cancer unmasks germline-encoded autoimmunity. Kleeman, S.O., Michalski, K., Zhao, X. et al. Nature (2026) 653:1216-1228. DOI 10.1038/s41586-026-10278-0 · PubMed

Other PDB entries of the same protein (UniProt Q05586 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GJ1 1.62 Å, NMDA bound to compound 339
5H8F 1.81 Å, Structure of the apo human GluN1/GluN2A LBD
9GIC 1.82 Å, NMDA bound to compound 345
3BYA 1.85 Å, Structure of a Calmodulin Complex
5H8Q 1.9 Å, Structure of the human GluN1/GluN2A LBD in complex with GNE8324
9GIF 1.9 Å, NMDA bound to compound 288
9GIB 1.95 Å, NMDA bound to compound 380
9MUM 1.97 Å, Crystal structure of GluN1/GluN2A ligand-binding domain in complex with Compound 11,…
9GID 2.0 Å, NMDA bound to compound 338
5KCJ 2.09 Å, Structure of the human GluN1/GluN2A LBD in complex with GNE6901
9GIG 2.09 Å, NMDA bound to compound 387
5I2N 2.12 Å, Structure of the human GluN1/GluN2A LBD in complex with…

Browse structure collections

About this viewer

MolViewer shows 10FD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.