10PI: JAK1 kinase

JAK1 kinase (JH1 domain) in complex with povorcitinib. Determined by X-ray diffraction at 1.54 Å resolution. Released 10 Jun 2026.

Method: X-ray diffraction
Resolution: 1.54 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,744
Mol. weight: 70.7 kDa
Ligands: A1C68
Released: 10 Jun 2026

Explore 10PI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

10PI contains 39 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	869-870	2	1
α-helix	872-874	3
β-strand	875-883	9	1
β-strand	887-894	8	1
β-strand	903-910	8	1
α-helix	916-930	15
β-strand	937	1	2
α-helix	938-939	2
β-strand	940-944	5	1
β-strand	953-957	5	1
β-strand	963	1	2
α-helix	964-971	8
α-helix	972-974	3
α-helix	977-996	20
β-strand	999-1000	2	3
α-helix	1006-1008	3
β-strand	1009-1013	5	2
β-strand	1016-1019	4	2
β-strand	1026-1027	2	3
α-helix	1028-1029	2
β-strand	1034-1036	3	4
α-helix	1045-1047	3
α-helix	1050-1055	6
β-strand	1057-1059	3	4
α-helix	1060-1075	16
α-helix	1080-1082	3
α-helix	1084-1092	9
α-helix	1097-1099	3
α-helix	1100-1110	11
α-helix	1114-1117	4
α-helix	1122-1130	9
α-helix	1136-1138	3
α-helix	1140-1141	2
α-helix	1142-1156	15

Chain B: 19 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	869	1	5
α-helix	872-874	3
β-strand	875-883	9	5
β-strand	887-894	8	5
β-strand	903-910	8	5
α-helix	919-930	12
β-strand	937	1	6
α-helix	938-939	2
β-strand	940-945	6	5
α-helix	946	1
β-strand	952-957	6	5
β-strand	963	1	6
α-helix	964-971	8
α-helix	972-974	3
α-helix	977-996	20
β-strand	999-1000	2	7
α-helix	1006-1008	3
β-strand	1009-1013	5	6
β-strand	1016-1019	4	6
β-strand	1026-1027	2	7
α-helix	1028-1029	2
β-strand	1034-1036	3	8
α-helix	1045-1047	3
α-helix	1050-1055	6
β-strand	1057-1059	3	8
α-helix	1060-1075	16
α-helix	1080-1082	3
α-helix	1084-1092	9
α-helix	1100-1109	10
α-helix	1114-1117	4
α-helix	1122-1130	9
α-helix	1136-1138	3
α-helix	1142-1156	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase JAK1	A, B	protein	297	Homo sapiens	P23458 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>10PI_1 Tyrosine-protein kinase JAK1 (chains A, B)
XMDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLK
KEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKY
AVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDS
PVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTR
LVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
A1C68	4-{3-(cyanomethyl)-3-[(4M)-3',5'-dimethyl-1H,1'H-[4,4'-bipyrazol]-1-yl]azetidin…	C23 H22 F5 N7 O	2

Water and common crystallization additives (EDO, DMS) are not listed.

Primary citation

Discovery of the Orally Bioavailable Isoform Selective Janus Kinase 1 (JAK1) Compound Povorcitinib (INCB054707) for the Treatment of Inflammatory and Autoimmune Diseases. Zhuo, J., Li, Y.L., Qian, D.Q. et al. J Med Chem (2026) 69:12830-12852. DOI 10.1021/acs.jmedchem.5c03753 · PubMed

Other PDB entries of the same protein (UniProt P23458 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N7A 1.33 Å, Structure of the human JAK1 kinase domain with compound 39
6N77 1.64 Å, Structure of the human JAK1 kinase domain with compound 15
6N7C 1.69 Å, Structure of the human JAK1 kinase domain with compound 56
6GGH 1.7 Å, Human jak1 kinase domain in complex with inhibitor
6RSH 1.71 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…
8S85 1.75 Å, Crystal structure of JAK1 JH1 domain in complex with an inhibitor
6RSD 1.76 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…
6N7D 1.78 Å, Structure of the human JAK1 kinase domain with compound 54
4GS0 1.8 Å, Crystal structure of SHP1 catalytic domain with JAK1 activation loop peptide
4L00 1.8 Å, Crystal structure of the apo Jak1 pseudokinase domain
6ELR 1.8 Å, Human jak1 kinase domain in complex with compound 7
6RSB 1.8 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…

Browse structure collections

About this viewer

MolViewer shows 10PI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.