N-Alkyl & N-Aryl Aminopyrazole Spirocarbamates: A Two-Pronged Lead Optimization Strategy to Identify Orally Bioavailable Plasma Kallikrein Inhibitors Compound 13 ((3'R)-1'-{5-amino-1-[(2S)-1,1,1-trifluorobutan-2-yl]-1H-pyrazole-4-carbonyl}-6-chloro-5-fluorospiro[[3,1]benzoxazine-4,3'-piperidin]-2(1…. Determined by X-ray diffraction at 1.73 Å resolution. Released 11 Mar 2026.
Explore 10QS in 3D Show helices and sheets RCSB PDB PDBe
10QS contains 11 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 392 | 1 | 1 |
| β-strand | 395-396 | 2 | 2 |
| β-strand | 405-411 | 7 | 3 |
| β-strand | 415-425 | 11 | 3 |
| β-strand | 428-431 | 4 | 3 |
| α-helix | 433-436 | 4 | |
| α-helix | 442-444 | 3 | |
| β-strand | 445-448 | 4 | 3 |
| β-strand | 453 | 1 | 4 |
| α-helix | 454-456 | 3 | |
| β-strand | 464 | 1 | 3 |
| β-strand | 466-471 | 6 | 3 |
| β-strand | 485-489 | 5 | 3 |
| α-helix | 492-495 | 4 | |
| α-helix | 501-502 | 2 | |
| β-strand | 503 | 1 | 2 |
| α-helix | 504 | 1 | |
| α-helix | 507-509 | 3 | |
| β-strand | 517-521 | 5 | 2 |
| β-strand | 534 | 1 | 4 |
| α-helix | 535 | 1 | |
| β-strand | 536-539 | 4 | 2 |
| β-strand | 542-543 | 2 | 2 |
| α-helix | 545-551 | 7 | |
| β-strand | 561-564 | 4 | 2 |
| β-strand | 572 | 1 | 1 |
| β-strand | 581-586 | 6 | 2 |
| β-strand | 589-598 | 10 | 2 |
| β-strand | 609-613 | 5 | 2 |
| α-helix | 614-617 | 4 | |
| α-helix | 618-628 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Plasma kallikrein | A | protein | 275 | Homo sapiens | P03952 (AlphaFold model) |
>10QS_1 Plasma kallikrein (chains A) KREAEANTGDNSVSTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWV LTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKL QAPLNYTEFQKPISLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQ KRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPG VYTKVAEYMDWILEKTQSSDGKAQMQSPAHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1C7M | (3'R)-1'-{5-amino-1-[(2S)-1,1,1-trifluorobutan-2-yl]-1H-pyrazole-4-carbonyl}-6-… | C20 H20 Cl F4 N5 O3 | 1 |
Water and common crystallization additives (MES) are not listed.
N ‐Alkyl and N ‐Aryl Aminopyrazole Spirocarbamates: A Two-Pronged Lead Optimization Strategy to Identify Orally Bioavailable Plasma Kallikrein Inhibitors. Merchant, R.R., Chernyak, N., Lopez, J.A. et al. ACS Med Chem Lett (2026) 17:744-749. DOI 10.1021/acsmedchemlett.6c00066 · PubMed
Other PDB entries of the same protein (UniProt P03952 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 10QS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.