9VWT: Plasma kallikrein light chain

The catalytic domain of human plasma kallikrein with peptide inhibitor 070. Determined by X-ray diffraction at 1.77 Å resolution. Released 6 Aug 2025.

Method: X-ray diffraction
Resolution: 1.77 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 2,073
Mol. weight: 27.94 kDa
Released: 6 Aug 2025

Explore 9VWT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9VWT contains 12 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-36	7	3
β-strand	38B-48	11	3
β-strand	51-54	4	3
α-helix	56-59	4
α-helix	62-65C	3
β-strand	65D-67	4	3
β-strand	72	1	4
α-helix	73-75	3
β-strand	83	1	3
β-strand	85-90	6	3
β-strand	95	1	5
β-strand	100	1	5
β-strand	104-108	5	3
α-helix	111-114	4
β-strand	115	1	6
β-strand	118	1	6
α-helix	120-121	2
β-strand	122	1	2
α-helix	123-125	3
α-helix	126-130	5
β-strand	136-140	5	2
β-strand	154	1	4
α-helix	155	1
β-strand	156-159	4	2
β-strand	162-163	2	2
α-helix	165-170	6
β-strand	180-183	4	2
β-strand	189	1	1
β-strand	198-203	6	2
β-strand	208B-215	10	2
β-strand	226-230	5	2
α-helix	231-234	4
α-helix	235-241	7

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	5	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plasma kallikrein light chain	A	protein	237	Homo sapiens	P03952 (AlphaFold model)
peptide inhibitor	B	protein	10	synthetic construct

Sequence of entity 1 (A), FASTA

>9VWT_1 Plasma kallikrein light chain (chains A)
IVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSG
ILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPISLPSKGDT
STIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGG
KDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQS

Sequence of entity 2 (B), FASTA

>9VWT_2 peptide inhibitor (chains B)
CPAYSXYLDC

Primary citation

Water-medicated specifically targeting the S1 pockets among serine proteases using an arginine analogue. Lin, H., Xu, M., Jiang, L. et al. Bioorg Chem (2024) 152:107734-107734. DOI 10.1016/j.bioorg.2024.107734 · PubMed

Other PDB entries of the same protein (UniProt P03952 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6I44 1.36 Å, Allosteric activation of human prekallikrein by apple domain disc rotation
2ANY 1.4 Å, Expression, Crystallization and the Three-dimensional Structure of the Catalytic Domain…
5TJX 1.41 Å, Structure of human plasma kallikrein
6T7P 1.42 Å, human plasmakallikrein protease domain in complex with active site directed inhibitor
5F8Z 1.5 Å, The crystal structure of human Plasma Kallikrein in complex with its peptide inhibitor…
5F8X 1.55 Å, The crystal structure of human plasma kallikrein in complex with its peptide inhibitor…
10LR 1.58 Å, N-Alkyl & N-Aryl Aminopyrazole Spirocarbamates: A Two-Pronged Lead Optimization Strategy…
10MW 1.62 Å, N-Alkyl & N-Aryl Aminopyrazole Spirocarbamates: A Two-Pronged Lead Optimization Strategy…
10MV 1.66 Å, N-Alkyl & N-Aryl Aminopyrazole Spirocarbamates: A Two-Pronged Lead Optimization Strategy…
6O1S 1.7 Å, Structure of human plasma kallikrein protease domain with inhibitor
10QS 1.73 Å, N-Alkyl & N-Aryl Aminopyrazole Spirocarbamates: A Two-Pronged Lead Optimization Strategy…
5F8T 1.75 Å, The crystal structure of human Plasma Kallikrein in complex with its peptide inhibitor…

Browse structure collections

About this viewer

MolViewer shows 9VWT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.