10TM: MOR

Cryo-EM structure of MOR bound with DAMGO. Determined by electron microscopy at 3.0 Å resolution. Released 27 May 2026.

Method: Electron microscopy
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,654
Mol. weight: 89.73 kDa
Ligands: CLR
Released: 27 May 2026

Explore 10TM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

10TM contains 30 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain F: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	68-94	27
α-helix	95-99	5
α-helix	104-120	17
α-helix	123-132	10
α-helix	138-172	35
α-helix	174-180	7
α-helix	183-196	14
α-helix	198-207	10
β-strand	208-213	6	2
β-strand	216-221	6	2
α-helix	227-238	12
α-helix	239-244	6
α-helix	245-261	17
α-helix	265-267	3
α-helix	273-305	33
α-helix	314-334	21
α-helix	335-340	6

Chain R: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	68-94	27
α-helix	95-99	5
α-helix	104-120	17
α-helix	123-132	10
α-helix	138-172	35
α-helix	174-180	7
α-helix	183-196	14
α-helix	198-207	10
β-strand	208-213	6	1
β-strand	216-221	6	1
α-helix	227-238	12
α-helix	239-244	6
α-helix	245-261	17
α-helix	265-267	3
α-helix	273-305	33
α-helix	314-335	22
α-helix	336-340	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mu-type opioid receptor	F, R	protein	388	Homo sapiens	P35372 (AlphaFold model)
Tyr-dal-gly-mea-eta	H, S	protein	5	Homo sapiens

Sequence of entity 1 (F, R), FASTA

>10TM_1 Mu-type opioid receptor (chains F, R)
MDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCP
PTGSPSMITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALAT
STLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIWTLCTMSVDRYIAVCHPVKALDF
RTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFI
FAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHI
YVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSSNI
EQQNSTRIRQNTRDHPSTANTVDRTNHQ

Sequence of entity 2 (H, S), FASTA

>10TM_2 TYR-DAL-GLY-MEA-ETA (chains H, S)
YAGFX

Ligands and cofactors

ID	Name	Formula	Copies
CLR	Cholesterol	C27 H46 O	4

Primary citation

cryo-EM structure of MOR-Gi1 complex protein bound with DAMGO. Zhang, H., Wacker, D., Zilberg, G. et al. To be published.

Other PDB entries of the same protein (UniProt P35372 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Y72 2.65 Å, positive allosteric modulator(BMS986122)-bound mu-opioid receptor-Gi complex
9PY4 2.78 Å, Primed-state loperamide-mu opioid receptor-Gi GDPbS complex (rebound)
8EFO 2.8 Å, PZM21-bound mu-opioid receptor-Gi complex
9WST 2.8 Å, Cryo-EM structure of DAMGO-muOR-Gz-scFv16 complex
8Y73 2.84 Å, positive allosteric modulator(MPAM-15)-bound mu-opioid receptor-Gi complex
9PA2 2.86 Å, PCP bound mu-opioid receptor in complex with Gi1
9PA5 2.92 Å, (S)-ketamine bound mu-opioid receptor in complex with Gi1
23SO 2.95 Å, Cryo-EM structure of the cebranopadol-mu opioid receptor-Gi complex
9VJT 2.97 Å, Cryo-EM structure of MST-OR complex
8K9K 2.98 Å, Full agonist-bound mu-type opioid receptor-G protein complex
9PUD 3.0 Å, Cryo-EM structure of MOR-Gi1 complex protein bound with DAMGO
9PXY 3.0 Å, Primed-state naloxone-mu opioid receptor-Gi GDPbS complex (rebound)

Browse structure collections

About this viewer

MolViewer shows 10TM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.