Structure of PDGFRb Kinase Domain Bound to JNJ-PDGFRBi-1. Determined by X-ray diffraction at 2.32 Å resolution. Released 20 May 2026.
Explore 11UE in 3D Show helices and sheets RCSB PDB PDBe
11UE contains 19 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 591-593 | 3 | |
| β-strand | 594 | 1 | 1 |
| α-helix | 597-599 | 3 | |
| β-strand | 600-608 | 9 | 1 |
| β-strand | 612-620 | 9 | 1 |
| β-strand | 628-636 | 9 | 1 |
| α-helix | 642-658 | 17 | |
| β-strand | 664 | 1 | 2 |
| β-strand | 667-671 | 5 | 1 |
| β-strand | 678-682 | 5 | 1 |
| β-strand | 688 | 1 | 2 |
| α-helix | 689-701 | 13 | |
| α-helix | 800-819 | 20 | |
| α-helix | 829-831 | 3 | |
| β-strand | 832-834 | 3 | 2 |
| α-helix | 836-838 | 3 | |
| β-strand | 840-842 | 3 | 2 |
| α-helix | 846-848 | 3 | |
| β-strand | 858-860 | 3 | 3 |
| β-strand | 863-865 | 3 | 3 |
| α-helix | 867-869 | 3 | |
| α-helix | 872-877 | 6 | |
| α-helix | 882-897 | 16 | |
| α-helix | 901-902 | 2 | |
| α-helix | 913-918 | 6 | |
| α-helix | 923-926 | 4 | |
| α-helix | 931-940 | 10 | |
| α-helix | 945-947 | 3 | |
| α-helix | 949-950 | 2 | |
| α-helix | 951-959 | 9 | |
| α-helix | 964-978 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Platelet-derived growth factor receptor beta | A | protein | 429 | Homo sapiens | P09619 (AlphaFold model) |
>11UE_1 Platelet-derived growth factor receptor beta (chains A) GAMDQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQLVLGRTLGSGAFG QVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACT KGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNALPVGLPLPSHVSL TGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVPSAPERTCRATLI NESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIM RDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNEQ FYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLLGEGYKKKYQQ VDEEFLRSD
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1DA1 | N-[2-(2,2-dimethylpyrrolidin-1-yl)ethyl]-6-methyl-5-({1-methyl-6-[(1-methyl-1H-… | C25 H33 N11 O | 1 |
Identification of an Inhaled Pulmonary Selective PDGFR Inhibitor with Sustained Target Engagement. Marsboom, G., Lu, T., Hong, Z. et al. J Aerosol Med Pulm Drug Deliv (2026):19412711261449635-19412711261449635. DOI 10.1177/19412711261449635 · PubMed
Other PDB entries of the same protein (UniProt P09619 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 11UE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.