2IUI: PI3-kinase p85 N-terminal SH2 domain

Crystal structure of the PI3-kinase p85 N-terminal SH2 domain in complex with PDGFR phosphotyrosyl peptide. Determined by X-ray diffraction at 2.4 Å resolution. Released 6 Jun 2006.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,087
Mol. weight: 30.66 kDa
Released: 6 Jun 2006

Explore 2IUI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2IUI contains 10 α-helices and 17 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
β-strand	13	1	1
α-helix	19-26	8
α-helix	29-30	2
β-strand	33-38	6	1
β-strand	47-53	7	1
β-strand	56-62	7	1
β-strand	63-65	3	2
β-strand	68-70	3	2
β-strand	77	1	2
α-helix	80-88	9
β-strand	105-106	2	1

Chain B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	1005-1008	4
β-strand	1013	1	3
α-helix	1019-1026	8
α-helix	1029-1030	2
β-strand	1033-1038	6	3
β-strand	1047-1053	7	3
β-strand	1056-1062	7	3
β-strand	1063-1065	3	4
β-strand	1068-1070	3	4
β-strand	1077	1	4
α-helix	1080-1088	9
β-strand	1105-1106	2	3

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	204	1	1
α-helix	205-206	2

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1205-1206	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3-kinase regulatory subunit alpha	A, B	protein	120	Homo sapiens	P27986 (AlphaFold model)
Platelet-derived growth factor receptor beta	C, D	protein	11	Homo sapiens	P09619 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2IUI_1 Phosphatidylinositol 3-kinase regulatory subunit alpha (chains A, B)
GMNNNMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKL
IKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKED

Sequence of entity 2 (C, D), FASTA

>2IUI_2 Platelet-derived growth factor receptor beta (chains C, D)
SIDYVPMLDMK

Primary citation

Crystal Structure of the Pi 3-Kinase P85 Amino- Terminal Sh2 Domain and its Phosphopeptide Complexes. Nolte, R.T., Eck, M.J., Schlessinger, J. et al. Nat Struct Biol (1996) 3:364. DOI 10.1038/NSB0496-364 · PubMed

Other PDB entries of the same protein (UniProt P27986 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GJI 0.9 Å, PI3K p85 N-terminal SH2 domain/CD28-derived peptide complex
5AUL 1.1 Å, PI3K p85 C-terminal SH2 domain/CD28-derived peptide complex
7CIO 1.1 Å, Molecular interactions of cytoplasmic region of CTLA-4 with SH2 domains of PI3-kinase
7RNS 1.14 Å, nSH2 domain of p85-alpha subunit of phosphatidylinositol 3-kinase in complex with an…
3I5R 1.7 Å, PI3K SH3 domain in complex with a peptide ligand
1H9O 1.79 Å, Phosphatidylinositol 3-kinase, P85-alpha subunit: C-terminal SH2 domain complexed with a…
2IUG 1.89 Å, Crystal structure of the PI3-kinase p85 N-terminal SH2 domain
1PBW 2.0 Å, Structure of BCR-homology (BH) domain
1PHT 2.0 Å, Phosphatidylinositol 3-kinase P85-alpha subunit SH3 domain, residues 1-85
2IUH 2.0 Å, Crystal structure of the PI3-kinase p85 N-terminal SH2 domain in complex with c-Kit…
4JPS 2.2 Å, Co-crystal Structures of the Lipid Kinase PI3K alpha with Pan and Isoform Selective…
7PG5 2.2 Å, Crystal Structure of PI3Kalpha

Browse structure collections

About this viewer

MolViewer shows 2IUI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.