1A0R: Transducin

Heterotrimeric complex of phosducin/transducin beta-gamma. Determined by X-ray diffraction at 2.8 Å resolution. Released 30 Dec 1998.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Bos taurus
Chains: 3
Atoms: 4,696
Mol. weight: 73.47 kDa
Ligands: FAR
Released: 30 Dec 1998

Explore 1A0R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A0R contains 19 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 5 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	4-25	22
α-helix	30-33	4
α-helix	38-41	4
β-strand	47-51	5	1
β-strand	58-63	6	2
β-strand	69-74	6	2
β-strand	78-83	6	2
β-strand	88-94	7	2
β-strand	100-105	6	3
β-strand	111-116	6	3
β-strand	120-125	6	3
β-strand	137-140	4	3
β-strand	146-151	6	4
β-strand	156-161	6	4
β-strand	166-170	5	4
β-strand	175-180	6	4
β-strand	187-192	6	5
β-strand	198-203	6	5
β-strand	207-212	6	5
β-strand	217-223	7	5
β-strand	229-234	6	6
β-strand	240-245	6	6
β-strand	250-254	5	6
β-strand	259-264	6	6
α-helix	272	1
β-strand	273-278	6	7
β-strand	284-289	6	7
β-strand	294-298	5	7
β-strand	304-308	5	7
α-helix	309-311	3
β-strand	317-320	4	1
β-strand	327-330	4	1
β-strand	336-339	4	1

Chain G: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	6-8	3
α-helix	11-26	16
α-helix	30-32	3
α-helix	33-48	16
α-helix	52-55	4

Chain P: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	21-35	15
α-helix	74-80	7
α-helix	87-105	19
β-strand	114-116	3	8
α-helix	120-128	9
β-strand	135-141	7	8
α-helix	148-161	14
β-strand	166-171	6	8
α-helix	172-175	4
α-helix	186	1
β-strand	188-193	6	8
β-strand	196-201	6	8
α-helix	204-207	4
α-helix	214-222	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transducin (beta subunit)	B	protein	340	Bos taurus	P62871 (AlphaFold model)
Transducin (gamma subunit)	G	protein	65	Bos taurus	P02698 (AlphaFold model)
Phosducin	P	protein	245	Bos taurus	P19632 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1A0R_1 TRANSDUCIN (BETA SUBUNIT) (chains B)
XSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNI
CSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTF
TGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNA
FATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDAL
KADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN

Sequence of entity 2 (G), FASTA

>1A0R_2 TRANSDUCIN (GAMMA SUBUNIT) (chains G)
PVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEFRDYVEERSGEDPLVKGIPEDK
NPFKE

Sequence of entity 3 (P), FASTA

>1A0R_3 PHOSDUCIN (chains P)
MEKAKSQSLEEDFEGQASHTGPKGVINDWRKFKLESEDSDSVAHSKKEILRQMSSPQSRD
DKDSKERFSRKMSVQEYELIHKDKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELESG
EQFLETIEKEQKITTIVVHIYEDGIKGCDALNSSLICLAAEYPMVKFCKIKASNTGAGDR
FSSDVLPTLLVYKGGELLSNFISVTEQLAEEFFTGDVESFLNEYGLLPEKEMHVLEQTNM
EEDME

Ligands and cofactors

ID	Name	Formula	Copies
FAR	Farnesyl	C15 H26	1

Primary citation

Phosducin induces a structural change in transducin beta gamma. Loew, A., Ho, Y.K., Blundell, T. et al. Structure (1998) 6:1007-1019. DOI 10.1016/S0969-2126(98)00102-6 · PubMed

Other PDB entries of the same protein (UniProt P62871 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5KDO 1.9 Å, Heterotrimeric complex of the 4 alanine insertion variant of the Gi alpha1 subunit and…
1GOT 2.0 Å, Heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
3V5W 2.07 Å, Human G Protein-Coupled Receptor Kinase 2 in Complex with Soluble Gbetagamma Subunits…
1TBG 2.1 Å, Beta-gamma dimer of the heterotrimeric G-protein transducin
1GP2 2.3 Å, G protein heterotrimer GI_ALPHA_1 BETA_1 GAMMA_2 with GDP bound
5WG4 2.31 Å, Human GRK2 in complex with Gbetagamma subunits and CCG257284
6B20 2.34 Å, Crystal structure of a complex between G protein beta gamma dimer and an inhibitory…
1GG2 2.4 Å, G protein heterotrimer mutant GI_ALPHA_1(G203A) BETA_1 GAMMA_2 with GDP bound
2TRC 2.4 Å, Phosducin/transducin beta-gamma complex
4MK0 2.4 Å, Crystal structure of G protein-coupled receptor kinase 2 in complex with a a rationally…
6U7C 2.44 Å, Human GRK2 in complex with Gbetagamma subunits and CCG258747
3PVU 2.48 Å, Bovine GRK2 in complex with Gbetagamma subunits and a selective kinase inhibitor (CMPD101)

Browse structure collections

About this viewer

MolViewer shows 1A0R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.