1A15: Sdf-1ALPHA

Sdf-1ALPHA. Determined by X-ray diffraction at 2.2 Å resolution. Released 12 Aug 1998.

Method: X-ray diffraction
Resolution: 2.2 Å
Chains: 2
Atoms: 1,083
Mol. weight: 15.71 kDa
Released: 12 Aug 1998

Explore 1A15 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A15 contains 4 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
α-helix	20-22	3
β-strand	23-31	9	1
β-strand	35-42	8	1
β-strand	48-51	4	1
α-helix	56-64	9

Chain B: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	2
α-helix	20-22	3
β-strand	23-29	7	1
β-strand	38-42	5	1
β-strand	48-50	3	1
β-strand	51	1	2
α-helix	56-61	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stromal derived factor-1ALPHA	A, B	protein	67		P48061 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1A15_1 STROMAL DERIVED FACTOR-1ALPHA (chains A, B)
KPVSLSYRCPCRFFESHVARANVKHLKILNTPACALQIVARLKNNNRQVCIDPKLKWIQE
YLEKALN

Primary citation

Crystal structure of chemically synthesized [N33A] stromal cell-derived factor 1alpha, a potent ligand for the HIV-1 "fusin" coreceptor. Dealwis, C., Fernandez, E.J., Thompson, D.A. et al. Proc Natl Acad Sci U S A (1998) 95:6941-6946. DOI 10.1073/pnas.95.12.6941 · PubMed

Other PDB entries of the same protein (UniProt P48061 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3GV3 1.6 Å, CXCL12 (SDF) in trigonal space group
6SHR 1.75 Å, X-ray crystal structure of cell-free protein synthesis (CFPS) produced SDF1-a
4UAI 1.9 Å, Crystal structure of CXCL12 in complex with inhibitor
2J7Z 1.95 Å, Crystal Structure of recombinant Human Stromal Cell-Derived Factor- 1alpha
1QG7 2.0 Å, Stroma cell-derived factor-1ALPHA (sdf-1ALPHA)
2NWG 2.07 Å, Structure of CXCL12:heparin disaccharide complex
3HP3 2.2 Å, Crystal structure of CXCL12
9UPV 2.7 Å, Cryo-EM structure of CXCR4 complexed with agonist SDVX1
4LMQ 2.77 Å, Development and Preclinical Characterization of a Humanized Antibody Targeting CXCL12
9UPU 2.8 Å, Cryo-EM strucutre of CXCR4 complexed with agonist SDV1a
8K3Z 2.81 Å, Cryo-EM structure of CXCR4 in complex with CXCL12
8U4O 3.29 Å, Structure of CXCL12-bound CXCR4/Gi complex

Browse structure collections

About this viewer

MolViewer shows 1A15 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.