1A38: 14-3-3 protein zeta

14-3-3 protein zeta bound to R18 peptide. Determined by X-ray diffraction at 3.35 Å resolution. Released 2 Mar 1999.

Method: X-ray diffraction
Resolution: 3.35 Å
Organism: Bos taurus
Chains: 4
Atoms: 3,554
Mol. weight: 60.28 kDa
Released: 2 Mar 1999

Explore 1A38 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A38 contains 24 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	3-14	12
α-helix	19-30	12
α-helix	38-66	29
α-helix	74-100	27
α-helix	101-105	5
α-helix	106-108	3
α-helix	112-131	20
α-helix	136-157	22
α-helix	167-176	10
α-helix	177-182	6
α-helix	185-201	17
α-helix	212-225	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein zeta	A, B	protein	245	Bos taurus	P63103 (AlphaFold model)
R18 peptide (phcvprdlswldleanmclp)	P, Q	protein	20

Sequence of entity 1 (A, B), FASTA

>1A38_1 14-3-3 PROTEIN ZETA (chains A, B)
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN

Sequence of entity 2 (P, Q), FASTA

>1A38_2 R18 PEPTIDE (PHCVPRDLSWLDLEANMCLP) (chains P, Q)
FHCVPRDLSWLDLEANMCLP

Primary citation

14-3-3zeta binds a phosphorylated Raf peptide and an unphosphorylated peptide via its conserved amphipathic groove. Petosa, C., Masters, S.C., Bankston, L.A. et al. J Biol Chem (1998) 273:16305-16310. DOI 10.1074/jbc.273.26.16305 · PubMed

Other PDB entries of the same protein (UniProt P63103 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V7D 2.5 Å, 14-3-3 protein zeta in complex with Thr758 phosphorylated integrin beta2 peptide
1A4O 2.8 Å, 14-3-3 protein zeta isoform
1A37 3.6 Å, 14-3-3 protein zeta bound to ps-RAF259 peptide

Browse structure collections

About this viewer

MolViewer shows 1A38 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.