Catalysis of a disfavored reaction: an antibody exo diels-alderase-tsa-inhibitor complex at 1.95 a resolution. Determined by X-ray diffraction at 1.95 Å resolution. Released 16 Feb 1999.
Explore 1A3L in 3D Show helices and sheets RCSB PDB PDBe
1A3L contains 19 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 8 |
| α-helix | 7-9 | 3 | |
| β-strand | 10-12 | 3 | 9 |
| β-strand | 18-25 | 8 | 8 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 9 |
| β-strand | 45-52 | 8 | 9 |
| β-strand | 56-59 | 4 | 9 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 8 |
| α-helix | 73-75 | 3 | |
| β-strand | 77-82 | 6 | 8 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 9 |
| β-strand | 100B-103 | 4 | 9 |
| β-strand | 107-111 | 5 | 9 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 10 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 11 |
| β-strand | 137-147 | 11 | 11 |
| β-strand | 148 | 1 | 10 |
| β-strand | 153-157 | 4 | 12 |
| α-helix | 162-164 | 3 | |
| β-strand | 171-173 | 3 | 11 |
| α-helix | 174-176 | 3 | |
| β-strand | 177-179 | 3 | 11 |
| β-strand | 184-194 | 11 | 11 |
| α-helix | 195-198 | 3 | |
| β-strand | 206-212 | 6 | 12 |
| α-helix | 213-215 | 3 | |
| β-strand | 217-222 | 6 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 1 |
| β-strand | 9 | 1 | 2 |
| β-strand | 13-14 | 2 | 3 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 27C | 1 | 4 |
| β-strand | 31 | 1 | 4 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-66 | 5 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-104 | 3 | 2 |
| β-strand | 106-107 | 2 | 3 |
| β-strand | 111 | 1 | 5 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 6 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 6 |
| β-strand | 140 | 1 | 5 |
| β-strand | 145-150 | 6 | 7 |
| β-strand | 153-155 | 3 | 7 |
| β-strand | 159-163 | 5 | 6 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 6 |
| α-helix | 183-187 | 5 | |
| β-strand | 191-198 | 8 | 7 |
| β-strand | 201-210 | 10 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Immunoglobulin FAB 13G5 (light chain) | L | protein | 217 | Mus musculus | P01837 (AlphaFold model) |
| Immunoglobulin FAB 13G5 (heavy chain) | H | protein | 218 | Mus musculus | P01869 (AlphaFold model) |
>1A3L_1 IMMUNOGLOBULIN FAB 13G5 (LIGHT CHAIN) (chains L) DIVLTQAAFSNPVTLGASASISCRSSKSLLNSNGIIHMYWYLQKPGQSPQLLIYQMSKLA SGAPDRFSGSGSGTDFTLRISRVEAEDVGVYYCAQNLELPYTFGGGTKLEIKRADAAPTV SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDTKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
>1A3L_2 IMMUNOGLOBULIN FAB 13G5 (HEAVY CHAIN) (chains H) EVQLEESGPELVRPGTSVKISCKASGYTFTNYWLGWVKQRPGHGFEWIGDIYPGGVYTTN NEKFRGKAILTADTSSSTAYMQLSSLTSEDSAVYFCARAGGYYTGGDYWGQGTSVTVSSA KTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDL YTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
| ID | Name | Formula | Copies |
|---|---|---|---|
| CFC | 1-carboxy-1'-[(dimethylamino)-carbonyl]ferrocene | C14 H15 Fe N O3 | 1 |
An antibody exo Diels-Alderase inhibitor complex at 1.95 angstrom resolution. Heine, A., Stura, E.A., Yli-Kauhaluoma, J.T. et al. Science (1998) 279:1934-1940. DOI 10.1126/science.279.5358.1934 · PubMed
Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1A3L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.