Role of the 6-20 disulfide bridge in the structure and activity of epidermal growth factor, NMR, 20 structures. Determined by solution NMR. Released 29 Jul 1998.
Explore 1A3P in 3D Show helices and sheets RCSB PDB PDBe
1A3P contains 0 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 19-22 | 4 | 1 |
| β-strand | 29-32 | 4 | 1 |
| β-strand | 37-38 | 2 | 2 |
| β-strand | 44-45 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Epidermal growth factor | A | protein | 45 | Mus musculus | P01132 (AlphaFold model) |
>1A3P_1 EPIDERMAL GROWTH FACTOR (chains A) PGAPSSYDGYCLNGGVAMHIESLDSYTCNCVIGYSGDRCQTRDLR
Role of the 6-20 disulfide bridge in the structure and activity of epidermal growth factor. Barnham, K.J., Torres, A.M., Alewood, D. et al. Protein Sci (1998) 7:1738-1749. PubMed
Other PDB entries of the same protein (UniProt P01132 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1A3P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.