1A4O: 14-3-3 protein zeta isoform

14-3-3 protein zeta isoform. Determined by X-ray diffraction at 2.8 Å resolution. Released 2 Mar 1999.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Bos taurus
Chains: 4
Atoms: 6,360
Mol. weight: 111.11 kDa
Released: 2 Mar 1999

Explore 1A4O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A4O contains 42 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	38-67	30
α-helix	74-100	27
α-helix	101-105	5
α-helix	113-131	19
α-helix	136-154	19
α-helix	167-175	9
α-helix	189-197	9
α-helix	200-202	3
α-helix	217-227	11

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	38-65	28
α-helix	74-100	27
α-helix	101-105	5
α-helix	114-132	19
α-helix	137-156	20
α-helix	167-176	10
α-helix	191-197	7
α-helix	199-201	3
α-helix	217-223	7

Chain C: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	3-14	12
α-helix	19-30	12
α-helix	38-67	30
α-helix	74-100	27
α-helix	101-105	5
α-helix	113-131	19
α-helix	136-156	21
α-helix	168-177	10
α-helix	191-199	9
α-helix	217-223	7

Chain D: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	38-67	30
α-helix	74-100	27
α-helix	101-105	5
α-helix	114-132	19
α-helix	136-159	24
α-helix	167-177	11
α-helix	189-200	12
α-helix	217-227	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein zeta	A, B, C, D	protein	245	Bos taurus	P63103 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1A4O_1 14-3-3 PROTEIN ZETA (chains A, B, C, D)
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN

Primary citation

Crystal structure of the zeta isoform of the 14-3-3 protein. Liu, D., Bienkowska, J., Petosa, C. et al. Nature (1995) 376:191-194. DOI 10.1038/376191a0 · PubMed

Other PDB entries of the same protein (UniProt P63103 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V7D 2.5 Å, 14-3-3 protein zeta in complex with Thr758 phosphorylated integrin beta2 peptide
1A38 3.35 Å, 14-3-3 protein zeta bound to R18 peptide
1A37 3.6 Å, 14-3-3 protein zeta bound to ps-RAF259 peptide

Browse structure collections

About this viewer

MolViewer shows 1A4O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.