1A5T: Delta prime

Crystal structure of the delta prime subunit of the clamp-loader complex of escherichia coli DNA polymerase III. Determined by X-ray diffraction at 2.2 Å resolution. Released 27 May 1998.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Escherichia coli K12
Chains: 1
Atoms: 2,715
Mol. weight: 37.05 kDa
Ligands: ZN
Released: 27 May 1998

Explore 1A5T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A5T contains 21 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
α-helix	8-19	12
β-strand	26-30	5	1
α-helix	37-48	12
β-strand	54	1	2
β-strand	57	1	2
α-helix	63-70	8
β-strand	76-79	4	1
β-strand	88	1	3
α-helix	90-99	10
α-helix	103-104	2
β-strand	110-114	5	1
α-helix	117-119	3
β-strand	120	1	3
α-helix	122-132	11
α-helix	135-136	2
β-strand	139-145	7	1
α-helix	148-150	3
α-helix	153-156	4
β-strand	160-163	4	1
α-helix	169-179	11
α-helix	184-193	10
α-helix	198-203	6
α-helix	208-226	19
α-helix	230-232	3
α-helix	233-236	4
α-helix	241-255	15
α-helix	271-280	10
α-helix	283-303	21
α-helix	308-322	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Delta prime	A	protein	334	Escherichia coli K12	P28631 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1A5T_1 DELTA PRIME (chains A)
MRWYPWLRPDFEKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQPQGHKSCG
HCRGCQLMQAGTHPDYYTLAPEKGKNTLGVDAVREVTEKLNEHARLGGAKVVWVTDAALL
TDAAANALLKTLEEPPAETWFFLATREPERLLATLRSRCRLHYLAPPPEQYAVTWLSREV
TMSQDALLAALRLSAGSPGAALALFQGDNWQARETLCQALAYSVPSGDWYSLLAALNHEQ
APARLHWLATLLMDALKRHHGAAQVTNVDVPGLVAELANHLSPSRLQAILGDVCHIREQL
MSVTGINRELLITDLLLRIEHYLQPGVVLPVPHL

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Crystal structure of the delta' subunit of the clamp-loader complex of E. coli DNA polymerase III. Guenther, B., Onrust, R., Sali, A. et al. Cell (1997) 91:335-345. DOI 10.1016/S0092-8674(00)80417-1 · PubMed

Other PDB entries of the same protein (UniProt P28631 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OYJ 2.53 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
9OYH 2.54 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
9OYI 2.54 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
8GJ2 2.6 Å, E. coli clamp loader with closed clamp on primed template DNA
9OYK 2.6 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
9OYM 2.6 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
1JR3 2.7 Å, Crystal Structure of the Processivity Clamp Loader Gamma Complex of E. coli DNA…
8GIZ 2.7 Å, E. coli clamp loader with open clamp
9OYN 2.7 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped…
9OYC 2.71 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 1-nt gapped…
9OYE 2.72 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 1-nt gapped…
9OYD 2.73 Å, Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 1-nt gapped…

Browse structure collections

About this viewer

MolViewer shows 1A5T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.