1A66: Core NFATC1/DNA complex, 18 structures

Solution NMR structure of the core NFATC1/DNA complex, 18 structures. Determined by solution NMR. Released 17 Jun 1998.

Method: Solution NMR
Organism: Homo sapiens
Chains: 3
Atoms: 1,891
Mol. weight: 27.33 kDa
Released: 17 Jun 1998

Explore 1A66 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A66 contains 1 α-helix and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	10	1	1
β-strand	13	1	1
β-strand	14-17	4	2
β-strand	28	1	3
β-strand	47	1	4
β-strand	48-51	4	2
β-strand	59-67	9	5
β-strand	96-98	3	5
β-strand	101-108	8	5
β-strand	117	1	4
β-strand	124	1	3
α-helix	128-132	5
β-strand	146-157	12	5
β-strand	161-173	13	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(cpgpapgpgpapapapaptptpg)-3')	B	DNA	12
DNA (5'-d(cpapaptptptptpcpcptpcpg)-3')	C	DNA	12
Core NFATC1	A	protein	178	Homo sapiens	O95644 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1A66_1 DNA (5'-D(*CP*GP*AP*GP*GP*AP*AP*AP*AP*TP*TP*G)-3') (chains B)
CGAGGAAAATTG

Sequence of entity 2 (C), FASTA

>1A66_2 DNA (5'-D(*CP*AP*AP*TP*TP*TP*TP*CP*CP*TP*CP*G)-3') (chains C)
CAATTTTCCTCG

Sequence of entity 3 (A), FASTA

>1A66_3 CORE NFATC1 (chains A)
MKDWQLPSHSGPYELRIEVQPKSHHRARYETEGSRGAVKASAGGHPIVQLHGYLENEPLM
LQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDC
AGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRS

Primary citation

Solution structure of the core NFATC1/DNA complex. Zhou, P., Sun, L.J., Dotsch, V. et al. Cell (1998) 92:687-696. DOI 10.1016/S0092-8674(00)81136-8 · PubMed

Other PDB entries of the same protein (UniProt O95644 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5SVE 2.6 Å, Structure of Calcineurin in complex with NFATc1 LxVP peptide
1NFA Human transcription factor nfatc DNA binding domain, NMR, 10 structures

Browse structure collections

About this viewer

MolViewer shows 1A66 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.