1NFA: Human transcription factor NFATC1

Human transcription factor nfatc DNA binding domain, NMR, 10 structures. Determined by solution NMR. Released 1 Apr 1997.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,404
Mol. weight: 19.99 kDa
Released: 1 Apr 1997

Explore 1NFA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NFA contains 1 α-helix and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	14	1	1
α-helix	41-43	3
β-strand	47-48	2	2
β-strand	51	1	1
β-strand	59-67	9	3
β-strand	74-75	2	3
β-strand	95-97	3	3
β-strand	102-108	7	3
β-strand	116-117	2	2
β-strand	147-152	6	3
β-strand	153-154	2	4
β-strand	164-165	2	4
β-strand	168-172	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human transcription factor NFATC1	A	protein	178	Homo sapiens	O95644 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NFA_1 HUMAN TRANSCRIPTION FACTOR NFATC1 (chains A)
MKDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLM
LQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDC
AGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRS

Primary citation

Unusual Rel-like architecture in the DNA-binding domain of the transcription factor NFATc. Wolfe, S.A., Zhou, P., Dotsch, V. et al. Nature (1997) 385:172-176. DOI 10.1038/385172a0 · PubMed

Other PDB entries of the same protein (UniProt O95644 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5SVE 2.6 Å, Structure of Calcineurin in complex with NFATc1 LxVP peptide
1A66 Solution NMR structure of the core NFATC1/DNA complex, 18 structures

Browse structure collections

About this viewer

MolViewer shows 1NFA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.