Oxy-myoglobin, atomic resolution. Determined by X-ray diffraction at 1.0 Å resolution. Released 6 Apr 1999.
Explore 1A6M in 3D Show helices and sheets RCSB PDB PDBe
1A6M contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-17 | 14 | |
| α-helix | 18-20 | 3 | |
| α-helix | 21-35 | 15 | |
| α-helix | 37-40 | 4 | |
| α-helix | 52-56 | 5 | |
| α-helix | 59-76 | 18 | |
| α-helix | 83-95 | 13 | |
| α-helix | 101-118 | 18 | |
| α-helix | 120-122 | 3 | |
| α-helix | 125-149 | 25 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myoglobin | A | protein | 151 | Physeter catodon | P02185 (AlphaFold model) |
>1A6M_1 MYOGLOBIN (chains A) VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASED LKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHP GDFGADAQGAMNKALELFRKDIAAKYKELGY
Water and common crystallization additives (SO4) are not listed.
Crystal structures of myoglobin-ligand complexes at near-atomic resolution. Vojtechovsky, J., Chu, K., Berendzen, J. et al. Biophys J (1999) 77:2153-2174. PubMed
Other PDB entries of the same protein (UniProt P02185 (AlphaFold model), which also has an AlphaFold model), best resolution first:
1A6M is part of these collections:
MolViewer shows 1A6M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.