1A6Y: Reverba orphan nuclear receptor/dna complex

Reverba orphan nuclear receptor/dna complex. Determined by X-ray diffraction at 2.3 Å resolution. Released 21 Oct 1998.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,334
Mol. weight: 34.45 kDa
Ligands: ZN
Released: 21 Oct 1998

Explore 1A6Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A6Y contains 5 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	100	1	1
β-strand	107	1	1
α-helix	108	1
β-strand	110-112	3	2
β-strand	115-117	3	2
α-helix	119-129	11
α-helix	154-161	8

Chain B: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	100	1	3
β-strand	107	1	3
β-strand	112	1	4
β-strand	115	1	4
α-helix	119-129	11
α-helix	154-164	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-D(CPAPAPCPTPAPGPGPTPCPAPCP(5IT)PAPGPGPTPCPAPG)-3')	C	DNA	20
DNA (5'-d(cptpgpapcpcptpapgptpgpapcpcptpapgptptpg)-3')	D	DNA	20
Orphan nuclear receptor NR1D1	A, B	protein	94	Homo sapiens	P20393 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>1A6Y_1 DNA (5'-D(*CP*AP*AP*CP*TP*AP*GP*GP*TP*CP*AP*CP*(5IT)P*AP*GP*GP*TP*CP*AP*G)-3') (chains C)
CAACTAGGTCACUAGGTCAG

Sequence of entity 2 (D), FASTA

>1A6Y_2 DNA (5'-D(*CP*TP*GP*AP*CP*CP*TP*AP*GP*TP*GP*AP*CP*CP*TP*AP*GP*TP*TP*G)-3') (chains D)
CTGACCTAGTGACCTAGTTG

Sequence of entity 3 (A, B), FASTA

>1A6Y_3 ORPHAN NUCLEAR RECEPTOR NR1D1 (chains A, B)
TKLNGMVLLCKVCGDVASGFHYGVLACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINR
NRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRM

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Structural elements of an orphan nuclear receptor-DNA complex. Zhao, Q., Khorasanizadeh, S., Miyoshi, Y. et al. Mol Cell (1998) 1:849-861. DOI 10.1016/S1097-2765(00)80084-2 · PubMed

Other PDB entries of the same protein (UniProt P20393 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GA5 2.4 Å, Crystal structure of the orphan nuclear receptor rev-erb(alpha) DNA-binding domain bound…
8D8I 2.5 Å, Crystal structure of Reverb alpha in complex with synthetic agonist
3N00 2.6 Å, Crystal Structure of a deletion mutant of human Reverba ligand binding domain bound with…
1HLZ 2.8 Å, Crystal structure of the orphan nuclear receptor rev-erb(alpha) DNA-binding domain bound…

Browse structure collections

About this viewer

MolViewer shows 1A6Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.