3N00: Rev-erbA-alpha

Crystal Structure of a deletion mutant of human Reverba ligand binding domain bound with an NCoR ID1 peptide determined to 2.60A. Determined by X-ray diffraction at 2.6 Å resolution. Released 30 Jun 2010.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,611
Mol. weight: 30.08 kDa
Released: 30 Jun 2010

Explore 3N00 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3N00 contains 12 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	285-299	15
α-helix	434-456	23
α-helix	460-462	3
α-helix	465-486	22
α-helix	509-511	3
α-helix	514-529	16
α-helix	534-546	13
α-helix	556-577	22
α-helix	584-589	6
α-helix	591-602	12
α-helix	605	1
β-strand	606-610	5	1

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2046-2050	5	1
α-helix	2051-2063	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rev-erbA-alpha	A	protein	245	Homo sapiens	P20393 (AlphaFold model)
Nuclear receptor corepressor 1	B	protein	21	Homo sapiens	O75376 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3N00_1 Rev-erbA-alpha (chains A)
MKKHHHHHHGPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASGSPYPHGRSG
RTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFN
VKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLFTAVVLVSAD
RSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNNMHSEKLLSF
RVDAQ

Sequence of entity 2 (B), FASTA

>3N00_2 Nuclear receptor corepressor 1 (chains B)
THRLITLADHICQIITQDFAR

Primary citation

Structure of Rev-erbalpha bound to N-CoR reveals a unique mechanism of nuclear receptor-co-repressor interaction. Phelan, C.A., Gampe, R.T., Lambert, M.H. et al. Nat Struct Mol Biol (2010) 17:808-814. DOI 10.1038/nsmb.1860 · PubMed

Other PDB entries of the same protein (UniProt P20393 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1A6Y 2.3 Å, Reverba orphan nuclear receptor/dna complex
1GA5 2.4 Å, Crystal structure of the orphan nuclear receptor rev-erb(alpha) DNA-binding domain bound…
8D8I 2.5 Å, Crystal structure of Reverb alpha in complex with synthetic agonist
1HLZ 2.8 Å, Crystal structure of the orphan nuclear receptor rev-erb(alpha) DNA-binding domain bound…

Browse structure collections

About this viewer

MolViewer shows 3N00 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.