Plastocyanin from spinach. Determined by X-ray diffraction at 1.6 Å resolution. Released 21 Oct 1998.
Explore 1AG6 in 3D Show helices and sheets RCSB PDB PDBe
1AG6 contains 4 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-5 | 4 | 1 |
| β-strand | 14-15 | 2 | 1 |
| β-strand | 18-21 | 4 | 2 |
| β-strand | 26-31 | 6 | 1 |
| β-strand | 37 | 1 | 3 |
| β-strand | 40-41 | 2 | 2 |
| α-helix | 43-45 | 3 | |
| α-helix | 52-55 | 4 | |
| α-helix | 57-58 | 2 | |
| β-strand | 63 | 1 | 3 |
| β-strand | 69-73 | 5 | 1 |
| β-strand | 78-83 | 6 | 2 |
| α-helix | 85-87 | 3 | |
| β-strand | 93-98 | 6 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Plastocyanin | A | protein | 99 | Spinacia oleracea | P00289 (AlphaFold model) |
>1AG6_1 PLASTOCYANIN (chains A) VEVLLGGDDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEE DLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
| ID | Name | Formula | Copies |
|---|---|---|---|
| CU | Copper (II) ion | Cu | 1 |
Crystal structure of spinach plastocyanin at 1.7 A resolution. Xue, Y., Okvist, M., Hansson, O. et al. Protein Sci (1998) 7:2099-2105. PubMed
Other PDB entries of the same protein (UniProt P00289 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1AG6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.