1AHR: Calmodulin

Calmodulin mutant with a two residue deletion in the central helix. Determined by X-ray diffraction at 1.8 Å resolution. Released 16 Jun 1997.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Gallus gallus
Chains: 1
Atoms: 1,266
Mol. weight: 16.64 kDa
Ligands: CA
Released: 16 Jun 1997

Explore 1AHR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AHR contains 7 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8-19	12
β-strand	26-27	2	1
α-helix	29-38	10
α-helix	45-55	11
β-strand	63-64	2	1
α-helix	65-92	26
β-strand	99-101	3	2
α-helix	102-111	10
α-helix	118-124	7
β-strand	135-137	3	2
α-helix	138-144	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin	A	protein	146	Gallus gallus	P62149 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1AHR_1 CALMODULIN (chains A)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN
GTIDFPEFLTMMARKMKDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVD
EMIREADIDGDGQVNYEEFVTMMTSK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

The structure of a calmodulin mutant with a deletion in the central helix: implications for molecular recognition and protein binding. Tabernero, L., Taylor, D.A., Chandross, R.J. et al. Structure (1997) 5:613-622. DOI 10.1016/S0969-2126(97)00217-7 · PubMed

Other PDB entries of the same protein (UniProt P62149 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2O5G 1.08 Å, Calmodulin-smooth muscle light chain kinase peptide complex
3GOF 1.45 Å, Calmodulin bound to peptide from macrophage nitric oxide synthase
3GP2 1.46 Å, Calmodulin bound to peptide from calmodulin kinase II (CaMKII)
2O60 1.55 Å, Calmodulin bound to peptide from neuronal nitric oxide synthase
1UP5 1.9 Å, Chicken Calmodulin
2BCX 2.0 Å, Crystal structure of calmodulin in complex with a ryanodine receptor peptide
2VB6 2.3 Å, Myosin VI (MD-insert2-CaM, Delta Insert1) Post-rigor state (crystal form 2)
5HIT 2.85 Å, Crystal Structure Analysis of Ca2+-calmodulin and a C-terminal EAG1 channel fragment
2BKI 2.9 Å, Myosin VI nucleotide-free (MDinsert2-IQ) crystal structure
6BNV 4.6 Å, CryoEM structure of MyosinVI-actin complex in the rigor (nucleotide-free) state,…
2KZ2 Calmodulin, C-terminal domain, F92E mutant
2M3S Calmodulin, i85l, f92e, h107i, l112r, a128t, m144r mutant

Browse structure collections

About this viewer

MolViewer shows 1AHR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.