1AK8: Calmodulin

NMR solution structure of cerium-loaded calmodulin amino-terminal domain (CE2-TR1C), 23 structures. Determined by solution NMR. Released 17 Sept 1997.

Method: Solution NMR
Organism: Bos taurus
Chains: 1
Atoms: 591
Mol. weight: 8.73 kDa
Ligands: CE
Released: 17 Sept 1997

Explore 1AK8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AK8 contains 4 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	27	1	1
α-helix	30-39	10
α-helix	45-52	8
β-strand	63	1	1
α-helix	65-74	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin	A	protein	76	Bos taurus	P62157 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1AK8_1 CALMODULIN (chains A)
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARK

Ligands and cofactors

ID	Name	Formula	Copies
CE	Cerium (III) ion	Ce	2

Primary citation

Solution structure of the paramagnetic complex of the N-terminal domain of calmodulin with two Ce3+ ions by 1H NMR. Bentrop, D., Bertini, I., Cremonini, M.A. et al. Biochemistry (1997) 36:11605-11618. DOI 10.1021/bi971022+ · PubMed

Other PDB entries of the same protein (UniProt P62157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IF7 1.6 Å, Structure of Calmodulin complexed with its first endogenous inhibitor,…
1FW4 1.7 Å, Crystal structure of E. Coli fragment TR2C from calmodulin to 1.7 a resolution
1PRW 1.7 Å, Crystal structure of bovine brain Ca++ calmodulin in a compact form
1CDM 2.0 Å, Modulation of calmodulin plasticity in molecular recognition on the basis of X-ray…
1CM1 2.0 Å, Motions of calmodulin-single-conformer refinement
1CM4 2.0 Å, Motions of calmodulin-four-conformer refinement
1LIN 2.0 Å, Calmodulin complexed with trifluoperazine (1:4 complex)
1XA5 2.12 Å, Structure of Calmodulin in complex with KAR-2, a bis-indol alkaloid
2F2O 2.17 Å, Structure of calmodulin bound to a calcineurin peptide: a new way of making an old…
1QIW 2.3 Å, Calmodulin complexed with N-(3,3,-diphenylpropyl)-N'-[1-R-(3,4-bis-butoxyphenyl)-ethyl]-p…
2FOT 2.45 Å, Crystal structure of the complex between calmodulin and alphaII-spectrin
2F2P 2.6 Å, Structure of calmodulin bound to a calcineurin peptide: a new way of making an old…

Browse structure collections

About this viewer

MolViewer shows 1AK8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.